KEGG   Felis catus (domestic cat): 111560806
Entry
111560806         CDS       T02385                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04664  Fc epsilon RI signaling pathway
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111560806
   04151 PI3K-Akt signaling pathway
    111560806
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111560806
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111560806
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560806
   04664 Fc epsilon RI signaling pathway
    111560806
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111560806
   05202 Transcriptional misregulation in cancer
    111560806
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111560806
  09163 Immune disease
   05310 Asthma
    111560806
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    111560806
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    111560806
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   111560806
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Haparin
  Cytokines
   111560806
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 111560806
NCBI-ProteinID: XP_023110932
LinkDB
Position
A1
AA seq 143 aa
MSNLPIMYLLLLLLGFQAPQAQGRPFTTYQLNQYLAKIDEIMKILNKLPLPSQDPLDPNE
TEILRENTLLRPNLDAFLKAAENFHEDGLLIWKNLKEFLPLLPTPTPRGDPIHIEEDNWV
DFQWKLTKYLEILDNFLNFKEKQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagcaaccttcccatcatgtaccttctcctgcttcttcttggattccaagcgcctcag
gcacaggggcggccctttacaacttaccagctgaaccaatacttggcaaagattgatgaa
attatgaagatcttaaacaagttacccttgccttcacaggaccccttggacccaaatgag
acagagatcctgagggaaaacacccttctgaggccaaacctggatgcattcttaaaagct
gcagaaaatttccatgaagatggactgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccaggggagacccaatccatatcgaggaggataactgggtt
gatttccaatggaaactgactaaatatctggaaatccttgataactttctgaatttcaag
gagaaacagtga

DBGET integrated database retrieval system