KEGG   Felis catus (domestic cat): 493699Help
Entry
493699            CDS       T02385                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00250  Alanine, aspartate and glutamate metabolism
fca00410  beta-Alanine metabolism
fca00430  Taurine and hypotaurine metabolism
fca00650  Butanoate metabolism
fca01100  Metabolic pathways
fca04727  GABAergic synapse
fca04940  Type I diabetes mellitus
Module
fca_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    493699 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    493699 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    493699 (GAD1)
   00430 Taurine and hypotaurine metabolism
    493699 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    493699 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    493699 (GAD1)
Enzymes [BR:fca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     493699 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 493699
NCBI-ProteinID: NP_001009225
Ensembl: ENSFCAG00000007099
UniProt: P14748
LinkDB All DBs
Position
C1
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacatatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcctgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaaaaacctgctttcctgtgaa
aacagcgacagggatggacgcttccggcgcacggagacggacttctccaacctgtttgct
cgagatctgcttccggctaagaacggggaagagcaaactgtgcagttcctactggaggtg
gtagacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
caccctgagtccctggaacagatcttggttgactgcagagacaccctgaagtatggggtt
cgtacaggtcaccctcgatttttcaaccagctctccactggactggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagggagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctctaacatgtacagcatc
atggccgctcgctacaagttcttcccggaagttaagacaaagggcatggcagctgttccc
aaactggtcctcttcacgtcagaacatagtcactattccataaagaaggctggagctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaagggatacgttcccctttat
gtcaatgcaactgctggtacaactgtttatggagctttcgatcccatacaggagattgca
gatatatgtgagaaatacaacctgtggctacatgtcgacgctgcctggggcggtgggctg
cttatgtccaggaagcaccgccacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctcggccatcctcgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaaa
cagtatgatgtctcctatgacactggggacaaggcaatccagtgtggccgccacgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggagctggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcatacaaatgtctgtttctggtatattccacaa
agcctcaggggcattccagatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagccccagggg
gacaaggccaactttttccggatggtcatctcgaacccagctgctacacagtccgatatt
gacttcctcatcgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system