Felis catus (domestic cat): 493935 Help Entry 493935            CDS       T02385                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism fca  Felis catus (domestic cat) Pathway fca01522   Endocrine resistance fca04010   MAPK signaling pathway fca04024   cAMP signaling pathway fca04210   Apoptosis fca04380   Osteoclast differentiation fca04620   Toll-like receptor signaling pathway fca04657   IL-17 signaling pathway fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04668   TNF signaling pathway fca04713   Circadian entrainment fca04725   Cholinergic synapse fca04728   Dopaminergic synapse fca04915   Estrogen signaling pathway fca04917   Prolactin signaling pathway fca04921   Oxytocin signaling pathway fca04926   Relaxin signaling pathway fca04928   Parathyroid hormone synthesis, secretion and action fca04932   Non-alcoholic fatty liver disease fca04935   Growth hormone synthesis, secretion and action fca05031   Amphetamine addiction fca05132   Salmonella infection fca05133   Pertussis fca05135   Yersinia infection fca05140   Leishmaniasis fca05142   Chagas disease fca05161   Hepatitis B fca05162   Measles fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05207   Chemical carcinogenesis - receptor activation fca05208   Chemical carcinogenesis - reactive oxygen species fca05210   Colorectal cancer fca05224   Breast cancer fca05231   Choline metabolism in cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     493935 (FOS)    04668 TNF signaling pathway     493935 (FOS)    04024 cAMP signaling pathway     493935 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     493935 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493935 (FOS)    04660 T cell receptor signaling pathway     493935 (FOS)    04658 Th1 and Th2 cell differentiation     493935 (FOS)    04659 Th17 cell differentiation     493935 (FOS)    04657 IL-17 signaling pathway     493935 (FOS)    04662 B cell receptor signaling pathway     493935 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     493935 (FOS)    04917 Prolactin signaling pathway     493935 (FOS)    04921 Oxytocin signaling pathway     493935 (FOS)    04926 Relaxin signaling pathway     493935 (FOS)    04935 Growth hormone synthesis, secretion and action     493935 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     493935 (FOS)   09156 Nervous system    04725 Cholinergic synapse     493935 (FOS)    04728 Dopaminergic synapse     493935 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     493935 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     493935 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493935 (FOS)    05207 Chemical carcinogenesis - receptor activation     493935 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     493935 (FOS)    05231 Choline metabolism in cancer     493935 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     493935 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     493935 (FOS)    05224 Breast cancer     493935 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     493935 (FOS)    05170 Human immunodeficiency virus 1 infection     493935 (FOS)    05161 Hepatitis B     493935 (FOS)    05171 Coronavirus disease - COVID-19     493935 (FOS)    05162 Measles     493935 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     493935 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     493935 (FOS)    05135 Yersinia infection     493935 (FOS)    05133 Pertussis     493935 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     493935 (FOS)    05142 Chagas disease     493935 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     493935 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     493935 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493935 (FOS)    05418 Fluid shear stress and atherosclerosis     493935 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     493935 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     493935 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:fca03000]     493935 (FOS)    04131 Membrane trafficking [BR:fca04131]     493935 (FOS) Transcription factors [BR:fca03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     493935 (FOS) Membrane trafficking [BR:fca04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     493935 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  493935 NCBI-ProteinID:  NP_001009341 EnsemblRapid:  ENSFCTG00005012814 UniProt:  Q8HZP6 LinkDB All DBs Position B3:120100001..120103418 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttcccagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggccggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacactccaagcggagacagatcaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtagagccggtcaagagcatc agcagcatggagctgaaggccgagcccttcgatgacttcctgttcccagcatcgtccagg cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system