KEGG   Felis catus (domestic cat): 493937
Entry
493937            CDS       T02385                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04640  Hematopoietic cell lineage
fca04916  Melanogenesis
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493937 (KITLG)
   04014 Ras signaling pathway
    493937 (KITLG)
   04015 Rap1 signaling pathway
    493937 (KITLG)
   04072 Phospholipase D signaling pathway
    493937 (KITLG)
   04151 PI3K-Akt signaling pathway
    493937 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493937 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    493937 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493937 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493937 (KITLG)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   493937 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 493937
NCBI-ProteinID: NP_001009343
Ensembl: ENSFCAG00000028734
UniProt: P79169
LinkDB
Position
B4
AA seq 274 aa
MKKTQTWIVTCIYLQLLLFNPLVKTKGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSS
ENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattgtcacttgcatttatcttcagctgctcctatttaac
cctctggtcaaaactaaagggctctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagt
ttgactgatcttctggacaagttttcgaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcgtggaaggacactcatct
gagaatgtaaaaaaatcatctaagagcccagaacccaggctttttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggacttggagatggtggcatctaaa
actagtgaatgtgtggtttcttcaacattaagtcctgaaaaagattccagggtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggccacaaatcccatagaagactccagcatacaatgggcagtcatggca
ttaccagcgtgcttttctcttgtaatcggatttgcttttggagccttctactggaagaag
aaacaaccgaatctcacaaggacagttgaaaatatacagattaacgaagaggataatgag
ataagtatgctgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system