KEGG   Felis catus (domestic cat): 493939
Entry
493939            CDS       T02385                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04625  C-type lectin receptor signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    493939 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    493939 (MDM2)
   04151 PI3K-Akt signaling pathway
    493939 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493939 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    493939 (MDM2)
   04115 p53 signaling pathway
    493939 (MDM2)
   04218 Cellular senescence
    493939 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    493939 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    493939 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493939 (MDM2)
   05202 Transcriptional misregulation in cancer
    493939 (MDM2)
   05206 MicroRNAs in cancer
    493939 (MDM2)
   05205 Proteoglycans in cancer
    493939 (MDM2)
   05203 Viral carcinogenesis
    493939 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    493939 (MDM2)
   05220 Chronic myeloid leukemia
    493939 (MDM2)
   05218 Melanoma
    493939 (MDM2)
   05219 Bladder cancer
    493939 (MDM2)
   05215 Prostate cancer
    493939 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    493939 (MDM2)
   05169 Epstein-Barr virus infection
    493939 (MDM2)
   05165 Human papillomavirus infection
    493939 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493939 (MDM2)
   01522 Endocrine resistance
    493939 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493939 (MDM2)
   04121 Ubiquitin system [BR:fca04121]
    493939 (MDM2)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     493939 (MDM2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    493939 (MDM2)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    493939 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 Menin zf-FPG_IleRS
Other DBs
NCBI-GeneID: 493939
NCBI-ProteinID: NP_001009346
Ensembl: ENSFCAG00000024456
UniProt: Q7YRZ8
LinkDB
Position
B4
AA seq 491 aa
MCNTNMSVSTDGAVSTSQMPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKDPVQELQEEKPSSSDLVSRPSTSSRRRTISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMPEKAKVENSTQVEEGFDVP
DCKRTTVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIHSSQEDVKEFEREETQ
DKEEIVEPSFPHNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctaccgatggtgctgtaagcacctcacagatgcca
gcttcggagcaagagaccctggttagaccaaagccattgctcttgaagttgttaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttaccttggccagtat
ataatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
ctcctaggggatttgtttggagtgccaagcttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagaacaattagtgagacagaggaacattcagatgaattacctggtgaacggcag
agaaagcgccacaagtctgatagtatttctctttcctttgatgaaagtcttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagcgaatcaacgggcactccgtca
aatccggatctcgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaac
agatgttgggctcttcgtgagaactggcttcctgaagataaagggaaagataaagggaaa
atgcctgagaaagccaaagtggaaaactcaacacaagtagaagagggctttgatgtccct
gattgtaaaagaactacagtgaatgattccagggaatcatgtgctgaggaaaatgatgat
aaaatcacacaggcctcccaatcccaagaaagtgaggactattctcagccatcaacttct
aacagcatcattcatagcagccaagaagatgtcaaagagtttgagagggaagaaacacaa
gacaaagaagaaatcgtggaacctagttttccccataatgccattgaaccttgtgtgatt
tgccagggtcgacctaaaaatggttgcattgttcatggcaaaacaggacatcttatggca
tgctttacttgtgcaaaaaagctaaagaagaggaataagccctgtccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system