KEGG   Felis catus (domestic cat): 751617Help
Entry
751617            CDS       T02385                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform X1
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00020  Citrate cycle (TCA cycle)
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fca_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    751617 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    751617 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    751617 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    751617 (SDHB)
   05012 Parkinson disease
    751617 (SDHB)
   05016 Huntington disease
    751617 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    751617 (SDHB)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     751617 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 751617
NCBI-ProteinID: XP_003989572
Ensembl: ENSFCAG00000010180
UniProt: A0A2I2U7F5
LinkDB All DBs
Position
C1
AA seq 281 aa AA seqDB search
MAAAAVGVSLRRRFPATALGGACLQACRGAQTVAATAPRIKKFAIYRWDPDKTGDKPRMQ
TYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDT
NLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREK
LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFS
LYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtcggagtctccttgaggcgccggttcccggccacggcccttggc
ggagcctgcctgcaggcctgccggggggcacagacagtggcagccacagctccccgaatc
aagaagtttgccatctaccgatgggacccagacaagacgggagataagcctcgtatgcaa
acttatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagatt
aagaatgaaatcgattcgactttgactttccgacgatcatgcagagaaggcatctgtggc
tcttgtgcgatgaacatcaacggaggcaacactctggcttgcacccgcaggattgacacc
aacctcagcaaagtctccaaaatctaccctcttccgcatatgtatgtgataaaggatctt
gttcccgacttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaag
aaggatgaatcccaggaaggcaagcagcagtacctgcagtccatagaagatcgtgagaaa
ctggacgggctgtatgagtgtattctctgtgcctgctgcagcaccagctgccccagctac
tggtggaacggagacaaatacctgggacctgcagtccttatgcaggcctatcgctggatg
atcgactccagagacgacttcacggaggagcgcctggccaagctgcaggacccgttctcc
ctgtatcgctgccacaccatcatgaactgcacgaggacctgccccaaggggctgaatcca
ggcaaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcgtca
gtgtaa

DBGET integrated database retrieval system