KEGG   Felis catus (domestic cat): 751619Help
Entry
751619            CDS       T02385                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00020  Citrate cycle (TCA cycle)
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fca_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    751619 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    751619 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    751619 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    751619 (SDHA)
   05012 Parkinson disease
    751619 (SDHA)
   05016 Huntington disease
    751619 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    751619 (SDHA)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     751619 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 751619
NCBI-ProteinID: XP_023095804
Ensembl: ENSFCAG00000030558
LinkDB All DBs
Position
A1
AA seq 665 aa AA seqDB search
MSGVRVVSRLLGARRLALTRAQWPATWQAGTCGFHFTIDGNKRSSAKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPPIKPNAGEESVMNLDKLRFADGTLRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKE
RIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDIKTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggtggtgtcgcggctgctgggcgcccggcgcctggcactgactagg
gcgcagtggcccgcgacatggcaggcaggcacctgcggttttcacttcactattgatggg
aataagaggtcttcagctaaagtttcagattcaatttctacgcaatacccggtagtggac
catgaatttgacgcggtggtggtaggcgctggaggggcaggcttgcgagctgcgtttggc
ctttccgaggcagggtttaacacggcctgcgtcacaaagctctttcctacgagatcacac
accgttgcggcccagggagggatcaatgctgctctggggaacatggaggaggacaactgg
aggtggcacttctacgacactgtgaaaggctccgactggctgggggaccaggatgccatc
cactacatgacagagcaggcccctgcttccgtggtagagctggagaattatggcatgcca
ttcagcagaactgaagatgggaggatctaccagcgtgcttttggtggacagagcctcaag
tttgggaaaggcgggcaggcccatcggtgctgctgtgtggctgaccgcactggccactcg
ctgctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtagagtat
tttgccttggatctcctgatggaaaatggagaatgtcgtggtgttattgcgctgtgcata
gaagacgggtccatccatcgcataagagcaaagaacactgttgtagctactggaggctac
gggcgcacctacttcagctgcacatctgcccacaccagcaccggtgacggcaccgccatg
gtcaccagggcaggccttccctgccaggacttggagttcgttcagtttcaccccacaggt
atatatggtgccggttgtctcattacagaagggtgccgtggagagggaggcattctcatt
aacagtcaaggcgaaagattcatggagcgatatgccccggttgcaaaggacctggcatcc
agagacgtcgtgtctcggtccatgactctggaaatacgtgaaggaagaggctgtggccct
gaaaaagatcacgtctacctgcaattgcaccacctgcccccagagcagctggccatacgg
ctgcctggcatttcagagacggccatgatcttcgcaggtgtagatgtcaccaaggagccc
atccccgtccttcccaccgtgcattataacatgggcggcattcccaccaactacaagggg
caggttctgaggcatgtgaatggccaggatcagatcgtgcccggcctgtatgcctgtggg
gaggctgcctgcgcctccgtgcatggtgccaaccgtcttggggcaaactcactcttggat
ctggttgtctttggtcgggcgtgtgccctgagtatcgcagagtcctgcagacccggagat
aaagttcctccaattaaaccaaatgctggagaagagtctgtcatgaatcttgataagttg
aggtttgctgatggaaccctaagaacatcagaactacgactcaacatgcagaagtcgatg
caaaatcatgccgcagtgttccgtgtgggaagtgtgttacaggaaggttgtgagaaaatc
agccagctctatggagacctaaaacatctgaagacatttgaccgaggaatggtctggaac
accgacctggtggagaccctagagctgcagaacctgatgctttgtgcacttcagaccatt
tatggagcggaggctcggaaggagtcacgtggtgctcatgccagggaagattataaggag
cggattgacgagtatgattactccaagcccatccaggggcagcagaagaagccatttgag
gaacactggaggaagcacaccctttcctatgtcgacatcaagactgggaaggtctccttg
gagtacagacccgtcattgacagaactttgaatgaggcagactgtgccacagtccctcca
gccattcgctcctactga

DBGET integrated database retrieval system