KEGG   Folsomia candida: 110842105Help
Entry
110842105         CDS       T05043                                 

Definition
(RefSeq) probable histone deacetylase 1-B
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fcd  Folsomia candida
Pathway
fcd04213  Longevity regulating pathway - multiple species
fcd04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110842105
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110842105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fcd03036]
    110842105
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110842105
Chromosome and associated proteins [BR:fcd03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110842105
   HDAC complexes
    Sin3A-HDAC complex
     110842105
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110842105
  Chromatin remodeling factors
   NuRD complex
    110842105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DUF3340
Motif
Other DBs
NCBI-GeneID: 110842105
NCBI-ProteinID: XP_021943510
LinkDB All DBs
Position
Unknown
AA seq 546 aa AA seqDB search
MATSAHARKKVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
AEEMTKFHSDDYIRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAG
AVKLNKEATDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTCSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDDSYESI
FVPIMTKVMETYQPGAVVLQCGADSLTGDRLGCFNLTLKGHSKCVEFVKKYHLPLLILGG
GGYTIRNVARCWTLETAVALGTDIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLD
KIKTRLFENLRMLPCAPGVQMHAIPEDAINTEDIDEDSKVNPDERVSIRASDKRVANENE
LSDSEDEGEGRKDQRSYKRKRLKQDEKNENANGAPESKSSDIKASAETGKVVKDEVSAVK
ADSDEVMTKAEENGSKSPARPPKSDSAPPVKSPVEADTPMETEDITDGKDEKEKPSATDP
PKTVAT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccacctctgcccacgcacggaagaaagtctgctactactacgacagcgacattggg
aactactattatggtcaagggcatcccatgaagccgcacaggatacgtatgacccacaat
cttctcctcaactatggattgtaccggaagatggaaatttataggccgcataaggctact
gctgaagagatgacaaagttccacagcgacgactacatccggtttctgcgaagcattcgg
cctgataatatgactgagtataacaagcaaatgcaacgattcaatgtgggtgaagattgt
ccagtctttgacggtctatacgagttttgccagttatctgccggaggctctgtcgcagga
gctgtcaagcttaacaaggaggcaactgatattgcgatcaactgggcaggaggtttgcat
cacgccaaaaagtctgaagcatctgggttttgctatgttaatgatattgtgttggctatt
cttgagctactcaaatatcatcagcgagttttgtacattgacattgatattcatcacgga
gatggtgttgaggaagcattctacactactgaccgagtgatgacatgctcttttcacaag
tacggagagtactttccagggacaggagacttgagggatattggagcaggcaaaggaaag
tattatgccgtcaattttcctcttcgagatggaattgatgatgactcgtacgaatctatt
ttcgtccccatcatgaccaaggttatggaaacctatcagcctggagcagtggttttgcaa
tgtggagcggattctttaactggagacagacttgggtgcttcaatctcacattgaaaggt
cactccaaatgtgtcgagttcgtcaaaaagtaccatcttcccttactcatccttgggggt
ggtggatacaccatacgaaatgtagcccgttgttggactctggaaactgctgttgctctt
gggactgacattgcaaatgaacttccctacaatgattatttcgagtattttggacctgat
ttcaaacttcacattagcccatccaacatggcgaaccaaaatacaccagagtacctggac
aaaatcaaaactcgattatttgaaaacttgaggatgctcccatgcgctcctggagtacaa
atgcatgctatccctgaggacgccatcaacacagaagacattgacgaggactcgaaagta
aatcctgatgaacgagtctccatccgtgcgtcagataagcgagtagctaatgaaaatgag
ctcagtgactcggaagatgagggagaaggccgaaaagatcaacggtcttacaaacgcaaa
cgtttgaagcaggacgaaaaaaatgaaaacgcgaatggagcacctgaatcaaaatcctcg
gatatcaaggcttctgctgaaactggtaaagttgtaaaagatgaggttagcgccgttaag
gctgacagtgacgaagttatgacaaaggctgaggaaaatggatctaaaagtcctgcacgt
cctccaaaatcggacagcgctcctccagtaaagtctcctgtggaggcagatactccgatg
gaaactgaagatatcactgatgggaaagacgagaaagagaaaccatcagccactgatcca
cccaaaacagtagcaacataa

DBGET integrated database retrieval system