KEGG   Folsomia candida: 110842155Help
Entry
110842155         CDS       T05043                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
  KO
K02358  elongation factor Tu
Organism
fcd  Folsomia candida
Brite
Translation factors [BR:fcd03012]
 Eukaryotic Type
  Elongation factors
   110842155
 Prokaryotic Type
   110842155
Mitochondrial biogenesis [BR:fcd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    110842155
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110842155
  Exosomal proteins of breast cancer cells
   110842155
  Exosomal proteins of colorectal cancer cells
   110842155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 CbiA cobW
Motif
Other DBs
NCBI-GeneID: 110842155
NCBI-ProteinID: XP_021943557
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MAFFIAFNRSRVGSGASVVMKAILGDGGSGVFSRSKATLSVGNNYQLFLRLGGGGRALSH
IRLTSGRQIQRDLTRRRFLSTSRALEAEKQVYQRDKPHCNVGTIGHVDHGKTTLTAAITR
VLSESNKSVKVKKYDEIDNAPEEKQRGITINVAHIEYATEARHYSHTDCPGHADYIKNMI
TGTAQMDGAILVVAATDGVMPQTREHLLLSKQIGIEHIVVFINKVDAADAEMVDLVEMEI
RELMSEMKFDGDKVPVIKGSALCALEGKNPEIGANAVKELLSAVDSFIPTPVRDLDKPFL
LPIENVYSIAGRGTVCTGRLERGVLKKGMECEVLGYSKSLKTTVTGIEMFHKILEEAQAG
DQLGALIRGIKRDEIRRGMVICKPGTMKTYDNIEAQVYVLSKEEGGRSRPFTSLIQLQMF
SRTWDAAVQVIIQGKDMIMPGEDAKLQLKLIRPMVLEKGQRFTLRDGFTTLGTGVITGMM
KSMTEAERQLMIEGRKGLEKKAKKEAATTKS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcttttttcatagccttcaacaggtcaagagttggcagtggcgcctccgtcgttatg
aaggcaatcctcggtgatggtgggagtggtgtcttttccaggtccaaggccaccctctcc
gtcggcaacaattatcaactctttcttcgtctgggaggaggaggaagagctttatctcac
attcgattaaccagtgggcgacaaattcagcgtgacttgactcgaaggcggttcctctca
acgtctcgtgctctcgaggccgaaaaacaagtctaccagagagacaaacctcactgtaat
gtgggcacgataggtcacgtggatcatggcaagactaccctcacagcggccatcacaagg
gttctctccgaatccaacaaatctgtgaaggtgaagaaatacgatgaaattgacaatgct
cctgaagagaagcaacgaggcattacgatcaacgtggctcacatcgaatacgccacggag
gcgaggcactattcacacacggattgtcccggacatgccgattatattaagaacatgatc
accggcacggcccaaatggacggggcgatcctagtcgttgcagcgactgatggagtcatg
ccccaaaccagggaacatctcctcctctcaaaacagattggaattgaacacattgtcgtc
tttattaacaaggttgatgccgccgatgctgaaatggttgacctagtggagatggagatt
cgcgaactaatgtccgaaatgaaatttgatggcgacaaagtcccagtgattaaaggatcc
gccttgtgcgccctggaagggaagaatccagaaattggggccaatgctgtcaaagaactc
ttaagcgccgtggattccttcatcccaacgcccgttcgtgatttggataagcctttctta
cttcccattgagaacgtgtacagcattgcggggagaggaacggtctgcacgggacgatta
gagaggggtgtgcttaaaaagggaatggaatgcgaagtgttgggctattctaaaagcctc
aaaactactgtcacaggaattgaaatgtttcataaaatattggaagaagcgcaagcaggt
gaccaacttggtgccctgattcgtggcattaaacgggatgaaattcgaagaggaatggtc
atttgcaaaccgggcacgatgaagacatatgacaatattgaagctcaggtttatgtgcta
agtaaagaagaaggtggtcgatctcgtcccttcacatctctcatccaactacaaatgttt
tccagaacttgggatgctgccgttcaagttatcatccaaggaaaagatatgatcatgccg
ggagaagatgccaaattgcagctgaaacttattcgccccatggtgttggagaagggtcag
cggttcacgcttcgcgacggatttaccaccttggggacaggagtcatcaccggcatgatg
aaaagcatgactgaggccgaacgtcaactcatgatcgaggggaggaaaggattggaaaag
aaggcaaagaaagaggctgccactaccaagtcataa

DBGET integrated database retrieval system