KEGG   Folsomia candida: 110843965Help
Entry
110843965         CDS       T05043                                 

Definition
(RefSeq) histone-lysine N-methyltransferase E(z)-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
fcd  Folsomia candida
Pathway
fcd00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110843965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fcd03036]
    110843965
Enzymes [BR:fcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110843965
Chromosome and associated proteins [BR:fcd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110843965
   Polycomb group proteins
    PRC2-EZH2 complex
     110843965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET preSET_CXC
Motif
Other DBs
NCBI-GeneID: 110843965
NCBI-ProteinID: XP_021945728
LinkDB All DBs
Position
Unknown
AA seq 960 aa AA seqDB search
MSGNASSSGRPIRNSTGGMSTSTSKNGSSALSLSKATTRRSSLSSSTKLLELGKTVLNGS
IKKSVKPSLISKNTRHSEESAKKTAKGGKAVNGHNNSNKNGSNTATSKNGKNDGDKTNGA
KNNSAIGPTPGCSKIAVVALGPLSPSSITIVESLKKHVRSEYMRLLNQKRQRKSCEAKYA
WNDNLSKMKGMLLEGTRYMKESRRPVVWECKPKESDEVKSEVSKSTRFMKRATITSSDMP
TQHCPIITINQISAIPNMFTWASVRTNLMVEDETVLHNIPYMGDEVLDHDGKFIEELIKN
YDGKVHGDKENSFVDNEVFVDLVKALQVTETTLRASMKSSWNKMVGMSSTSKDKDAAASD
QVKIEGGIGKISDARILALSEKLAKRKTKLPSPSVFKAISDIYPERGTPQELRERFVELL
EKMEPGVVVSECTPNIDGPTAESVPPEQTMHSYHSLFCRRCFKYDCFLHRLKTDHPGPKT
VLKKKPLEAKPTVPCSSQCFLLLDEVKQRLAIQAALQAKAEKELEASMAEVSRPKKIRKQ
NSLESGDEDSNDSTKVVGNGGRKERKNGNSSHSNTNGNGKLNNDKSNNNGDKRRESKESL
DSNKSNNEKCNNGNGSNVIINESESSSGVMLGPSFLDVFQSKLPEWTSAECSLFRSIHKV
YGSNYCCISRTMLSRSCQEVYHFAQKEAQDVLTEESSKELTPPRKKAKKKNRLWSLHCRK
IQLKKDDSSSHVYSYTPCDHPGTPCDKSCPCVAMSNFCEKFCLCSLECQNRFPGCRCKAQ
CNTKQCPCYLAVRECDPDLCSICGADQHDVTKINCKNVSCQRGLHKHLLMAPSDIAGWGI
FLKESALKNEFISEYCGEVITQDEADRRGKVYDRHMCSFLFNLNNDFVVDATRKGNKIRF
ANHSVHPNCYAVIKMVNGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREVDIV
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaacgccagcagtagcggtcgtcccatccgaaattcgacggggggtatgagc
acatccaccagcaagaatgggtcatcagcattatccttgtctaaagcaacgacgcgaagg
tccagtctgtcctcttcgacgaagctgctcgaacttggtaaaactgtgctcaacgggtct
atcaaaaaatctgtgaaaccaagtcttatctcgaaaaatacacgtcattctgaagaaagt
gccaaaaaaactgccaagggggggaaagctgtcaatgggcataataatagcaataagaat
gggagtaatactgctacgtctaagaatgggaagaatgatggggataagacgaatggggcg
aaaaataatagtgcgataggtcccactcctgggtgttccaagattgccgtcgtcgcctta
ggaccgctttctccatcatccatcaccatagtcgaatcgctcaaaaaacacgttcgctcg
gaatacatgaggctccttaaccaaaaaagacaacggaaaagttgtgaggcaaagtatgct
tggaatgataacctgtcaaaaatgaagggaatgttgcttgaaggaactcgatacatgaaa
gaatcccgtcgtcccgtcgtttgggaatgcaaacctaaagaatctgatgaagtcaaaagt
gaggtttcaaagtcgacacggtttatgaaacgagcaaccatcacatcttccgacatgcct
acacagcactgcccgataattacgattaatcaaataagcgcaattccaaacatgtttact
tgggcttcagtaagaacaaacttgatggttgaagacgaaaccgtcctgcataacattcca
tacatgggggacgaagttttggatcatgatgggaaattcattgaagaacttataaaaaat
tatgacgggaaagttcatggagacaaggaaaatagttttgtggacaatgaagtatttgtt
gatttggtgaaagccttgcaagttacggagactactttgagagcttcaatgaagtccagc
tggaacaagatggtaggaatgagtagtactagtaaggataaggatgcagcagcctcagac
caagtcaagatagaaggaggaattggaaaaatttcagatgcacgaattttagccttgtca
gagaaattggctaaacgcaaaacaaaactgccctcgcctagtgtattcaaagctatttct
gacatatatcccgaacgtggcacgccacaggagttgagagaacgtttcgttgaactttta
gagaaaatggagcctggcgtagttgtctcggaatgtacaccaaatattgatggtcccact
gccgagtccgtacctccggaacaaactatgcattcttatcacagcctattttgcagacgc
tgttttaaatatgattgctttttgcatcgattaaagactgatcacccaggtccgaagacc
gtattaaagaagaagcctctcgaagccaaacctacagttccttgcagctcgcaatgtttc
ctgctcttggacgaagtcaaacaacgactcgctatccaagctgctcttcaagccaaggcc
gaaaaggagttggaagcatcaatggcggaagtgtcccgaccaaagaaaatacgcaaacaa
aattctctagaatctggcgatgaggacagcaatgatagcactaaagtggttggaaatggt
gggaggaaagaaaggaagaatggaaactcttctcactcaaatacgaatggaaatgggaag
cttaataacgataaatccaacaataacggggacaagaggcgagaatccaaggaatcattg
gattcaaataaatccaacaatgaaaaatgcaacaatgggaacgggtctaatgttattatt
aatgagtctgagtcgtcttcgggggtaatgctaggtcccagttttttggatgtctttcaa
tctaaattgccagaatggacaagtgctgaatgcagtctttttcggtcaattcacaaagtt
tatggttcaaattattgctgcatttcacgaacaatgctaagccgtagttgtcaggaggta
taccactttgctcagaaagaagctcaggatgtgctcaccgaagaatcatccaaggaacta
actcctcctagaaagaaggcaaaaaagaagaatcggttgtggtctctacattgcagaaaa
atccaattgaagaaagacgactcatcaagccatgtgtacagctatactccatgtgaccat
cctggcactccttgcgacaaaagttgtccatgcgttgcaatgtcaaacttttgcgaaaag
ttttgtctgtgcagtttagaatgccagaataggtttccaggttgtcgatgtaaagcgcag
tgtaacaccaaacagtgtccttgttacttggctgtacgagagtgcgaccctgacctttgc
tcgatttgtggagcggaccaacacgatgtgacaaagataaactgcaaaaacgttagttgt
cagcgtggattgcataagcatttactcatggccccttccgatattgccggatggggaata
ttccttaaggagtcagccctaaagaacgagttcataagtgaatattgtggcgaggttatt
actcaagatgaggctgatcgacgaggaaaagtttacgacaggcatatgtgcagcttcctg
ttcaatctcaacaatgattttgtggtggatgcaactcgcaaaggaaacaaaattcgattc
gctaatcattccgtgcatccaaattgctacgctgtcatcaagatggttaacggtgaccat
cgtattggcattttcgccaaacgcgcaatacaaccaggcgaggaattgttttttgattat
cgatacggtccaactgaacagttaaagtttgtcggaatcgaacgcgaagtggacattgtg
taa

DBGET integrated database retrieval system