KEGG   Folsomia candida: 110845478Help
Entry
110845478         CDS       T05043                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fcd  Folsomia candida
Pathway
fcd00020  Citrate cycle (TCA cycle)
fcd00190  Oxidative phosphorylation
fcd01100  Metabolic pathways
fcd01200  Carbon metabolism
Module
fcd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fcd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fcd_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110845478
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110845478
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110845478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 110845478
NCBI-ProteinID: XP_021947602
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MAAVRLAQHFGNAVSRKVLFGNPHGSSTLPIWSASSCPRNYHLSSGSRDKSSTTTMAKGY
PVIDHTFDAVVVGAGGAGLRAAFGLVEEGFKTAVITKLFPTRSHTVAAQGGINAALGNME
EDNWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVVELENYGMPFSRTDDGKIYQRAFGG
QSLKYGKGGQAHRCCCVADRTGHSLLHTLYGQSLKYDCQYFVEYFALDLLMEGGECRGVI
ALCLEDGTIHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRAGLPNQDLEFVQF
HPTGIYGAGCLITEGCRGEGGFLINGQGERFMERYAPNAKDLASRDVVSRAMTLEIREGR
GCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPT
NYKGQALTHGKSGDKIIPGLYAAGESASASVHGANRLGANSLLDLVVFGRACAKTIAAEN
KPGDTIGTLSSNAGEFSIANLDKLRHADGKVKVADLRLKMQKSMQSHAAVFRTGQVLQEG
VKEINNIYKEMSDLKLYDRGMVWNSDLVEALELQNLMINAVLTITGAEARKESRGAHARE
DFKDRIDEFDFSKPTSGQTPRPYEQHWRKHTLSWINTNSGQVTLTYRPVIDTTLSSAECA
TVPPAVRSY
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtcaggctggctcagcactttgggaatgctgtatccagaaaagtgttgttt
ggaaatcctcacggcagttccactcttccaatttggtcggcttcttcatgcccaaggaat
tatcacctgtcttctggaagcagggacaagtcttcgaccaccacgatggcaaagggatat
cctgtgattgaccacaccttcgatgccgttgttgtgggagctggcggagccgggcttcga
gcagcgtttggactggttgaagaaggtttcaaaaccgccgtgattactaagctatttcct
acgaggtctcacaccgttgctgctcaaggcggcataaacgcggctttagggaacatggag
gaagataattggaagtggcacatgtacgatacagtcaaagggtctgactggcttggagat
caagatgccattcattacatgaccagagaggctccaaaggcagttgtcgagctagaaaac
tacggaatgccgtttagtagaactgacgatggtaaaatttatcagagagcgtttggagga
cagtctttaaagtatggaaagggtggacaggcacatcgttgttgttgtgtcgccgataga
actggtcattctctcctccatacattgtatggtcaatcactcaagtatgattgtcagtat
tttgttgagtatttcgccctcgatctgctgatggaaggaggcgaatgtagaggtgttatc
gcactctgtctcgaggatggaactatccatagatttcgagcaaagaatactgtcttggct
actggagggtacggaagggcatacttttcttgtacatccgctcacacttgtactggggat
ggtactgctatggtctctcgagctggtcttcccaaccaagatttggaatttgtccaattt
catccaactggaatttatggtgcaggatgcctaattactgagggatgtagaggtgaaggg
gggtttcttatcaacggtcaaggtgaacgattcatggaaagatacgctcccaatgcaaag
gatttagcgtctcgcgatgttgtatctcgtgccatgacacttgaaatccgtgaaggtcgt
ggttgtggaccagaaaaagatcacgtctatcttcagcttcaccacttgcctccagagcag
ttggcgaccagactacctggaatttctgaaactgccatgattttcgctggggtcgatgtt
actcgagaaccaattccggttctgcctactgtccactacaatatgggaggtattccaact
aattacaaagggcaagccctcacacatggcaagtcgggcgacaaaattatacctgggctg
tacgcagcgggcgagtctgcgtctgcctctgtgcatggagctaatcgacttggagcaaat
tcattactcgatttggtcgtatttggtcgtgcatgtgcaaagacaattgctgcagaaaac
aaacctggcgatactatcggtacactttccagcaatgcaggagagttttctattgccaat
ttagacaaattgcgtcatgctgatggaaaagttaaagttgccgatttgaggctgaaaatg
cagaaaagtatgcaatcccatgctgcagtatttaggactggacaagtgttacaagaagga
gttaaggagattaataacatctacaaagaaatgagtgatctcaagttatatgatagagga
atggtttggaattcagacttggtagaagctctagaactgcaaaacttgatgatcaacgca
gttttgacaatcacaggggccgaagccagaaaagaatcacgcggagctcacgctagagaa
gactttaaagatcgaattgacgaatttgacttttcaaaacccaccagtggtcaaacccct
cgtccatacgaacagcattggcgtaaacatacgctgtcatggattaataccaatagtggt
caagtaactttgacgtacagaccagttatcgatacaaccttaagcagtgccgaatgcgcc
accgttcccccagcagtccgctcatattaa

DBGET integrated database retrieval system