KEGG   Folsomia candida: 110845863Help
Entry
110845863         CDS       T05043                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fcd  Folsomia candida
Pathway
fcd00052  Galactose metabolism
fcd00500  Starch and sucrose metabolism
fcd01100  Metabolic pathways
fcd04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110845863
   00500 Starch and sucrose metabolism
    110845863
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110845863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110845863
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110845863
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110845863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 110845863
NCBI-ProteinID: XP_021948080
LinkDB All DBs
Position
Unknown
AA seq 983 aa AA seqDB search
MTKFNTYSKVNTTIGIRMKVLRGGQLVDENNGVELDEDEFQHLIVMTSPQNPQWKWVAGL
RLIFFAFLAVTLATVLFIVVKDYTQAQLTWLMQPVNKSQLLNLHHLQTNPPVGGNATSLD
SSTSLDSCLIDDGWKFDCHPANVATADDCLNRGCCWKPLEVHNLPWCYYPLGFAYYVFTE
FVPTKTGLRGSAVSTRASPYPKDVKNLNVDIIYETEDIVRIRITDAKNSRYEVPFEYSKT
SYDKKPDILNYSVVTSRYGIQIFRSAEKTPVFDTTIAPMIYSNQYLEISTTLQTHYLYGI
GESVDFLKRTTNGSRYVLYNHDRIPGSNTNNYGSHPFYMIMDKMGRSHGVFLANSNAMEI
TVQSAPSLTFRTLGGILDLRIFVGPKPRDVTDQYTQIIGRPMIPPYWSLGYHLCRFNYGT
LNHTAEILQNNLQGGLPIDVQWNDLDYMHHSNDFTYDPVKFAGLPDFIDDIHSKGMRYVP
LIDPGISSGEAKGKYIPYEMGVEMDIFIKNSQGHIFEGHVWNKKGTVWPDFSHPNVTHYW
MRQLDSFRKRIKFDGAWIDMNEPSNFYNGEKNGCIKTSVLDNPPYVPRQIDGNTLYYKTI
CPSAKQAGGTHYDLHNLYGTQETIATYKALGDIVSERPFIISRATFPGQGRYGGHWTGDV
VSNWEDLRQTIPQILTFGLFGIPMVGADICGFNGNATADLCKRWQQLGAFYPFARNHNTD
DGIPQDPWSMGKDVFEAAKETLKVRYDLLPYIYSLFFRAHLSGRPVARALFFEFPKDVLT
FGIDTQFMLGPGVMIVPILEENYTKNTIPAYLPKGFWYHHYYLNDVIESLGEVHDLQIPV
HSIPILYQGGSIIVKQKGEQNTVLSRKNKFSIEAFLSSDDTADGEFFWDDGVSNLPKELV
QYNQYSFKVSKNVLTMTTVFGGYDSSSMVLGDITVRGVRGSVTSAILNNVDFPFSFENKV
LTLTNMTLQGPSGWTDGLTLVWS
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttaatacttattctaaagttaacacaactattgggattcgtatgaaagtt
ctacgagggggtcagctcgtggatgagaataatggggtcgagttggacgaggacgagttt
caacatttaattgtcatgacctccccccaaaacccgcagtggaaatgggtcgcaggtctt
cgactcatcttcttcgcctttctcgccgtcactctcgccacggtcctgttcatcgttgtc
aaagactacacccaagcccaactaacttggctgatgcagccagtaaataaatctcagttg
ctcaatctccaccacctccagacgaatcctcccgttggaggaaacgccaccagtcttgat
agttcgacatcacttgacagttgcttaattgacgatgggtggaagtttgattgtcaccct
gcgaacgttgctacggcggacgattgcctcaatcgagggtgttgttggaaaccacttgag
gtccataatttgccgtggtgctactatcccttgggtttcgcatattatgtgttcacggaa
tttgttccaacgaaaactggtctgaggggatctgcggtgtcaacaagagcatctccttac
ccgaaggatgttaaaaatttaaatgttgatatcatttatgagactgaggatattgttcga
attagaatcactgacgccaaaaattcccgatatgaagtaccttttgagtatagtaaaact
tcctatgataaaaaacctgacattttgaactactctgttgtaacttcccgttacggtata
caaatattccggagtgcagagaaaactcctgtatttgacacgacaattgctccaatgatt
tactctaatcagtaccttgagatctctacaacgctgcaaactcattatttatatggaatt
ggagaatctgtagattttttgaaaagaacaacaaacgggtctcgctatgttctgtacaat
cacgacagaattccaggatcaaacacgaataattatgggagtcacccattttacatgata
atggacaagatgggaagaagccatggggtctttttggcaaatagcaatgctatggaaata
acagtgcagtctgcaccctcactaacatttagaacacttgggggaatacttgaccttcga
atattcgtgggacctaaacctcgagacgtaactgaccaatacacgcaaattattggaaga
cctatgattcctccatactggtcgttgggttatcacttgtgtcgattcaactatgggact
ctcaaccataccgccgaaattttgcaaaataatttgcaaggtggacttccaatagatgtc
caatggaacgatttggattacatgcatcattcaaatgattttacatatgatcctgttaaa
tttgctggcctcccagatttcattgacgatattcacagtaagggaatgcgttatgtccct
ttgattgaccccggaattagtagtggagaagcgaaaggaaaatatataccgtatgaaatg
ggcgtagaaatggacatttttatcaaaaattctcaagggcatatttttgaagggcatgtg
tggaataaaaagggcacagtttggcctgacttttcacatccaaatgtcacccactattgg
atgagacaacttgattccttcagaaagagaattaaatttgatggagcctggattgacatg
aatgagccttccaatttttacaatggtgaaaagaatggttgtatcaaaacttcggtgttg
gacaaccctccgtatgttcctcgccaaattgatggaaacacgctgtactacaaaacaatc
tgcccttctgccaagcaagccgggggcacacactacgacctgcacaatctgtacggaacc
caagagacgatcgcgacttataaagcgctgggtgatattgttagtgaaaggccgtttatt
atatcccgagcaaccttccccggtcaaggcagatatggaggccattggacgggcgacgta
gtatccaactgggaagatttgcgtcaaaccataccacagattcttacatttggtctgttt
ggaattccaatggtaggggcggatatttgtggatttaatggcaacgcaactgctgattta
tgcaaacgttggcaacaattgggtgcattttatccatttgcaaggaaccacaatacagat
gacggcattcctcaagatccttggtcaatgggcaaagatgtattcgaggctgcaaaagaa
actttaaaagttcgatatgaccttctcccgtacatttactccttgttcttcagagcacat
ctttcaggaaggccagtcgcacgagcattatttttcgaatttccgaaggatgttcttaca
tttggaattgacactcaatttatgcttggacctggtgtaatgattgttccaattttagaa
gaaaattatacgaaaaacaccattcctgcatatcttccaaagggattttggtatcatcac
tactatttgaatgacgttatcgagtcgcttggagaagtgcacgatctgcagataccagta
cactcgataccaattttatatcaaggtgggagcattattgtaaaacaaaagggtgaacaa
aacactgtgctctctcgaaaaaataagtttagcattgaggcatttttatcatccgatgat
actgctgacggagagttcttttgggacgacggagtatccaaccttccaaaagaattagta
cagtacaatcagtacagctttaaagtatcaaaaaatgttctcacaatgacaacagttttt
gggggctatgattcttcgagtatggttttgggagacatcaccgtccgaggagtacgtggc
tcggtaaccagtgcaattctaaacaacgtggattttccgtttagtttcgaaaataaggtt
ttaacactgacgaatatgacacttcaaggcccttctggatggactgatggcttgacgctc
gtttggagttaa

DBGET integrated database retrieval system