KEGG   Folsomia candida: 110848322Help
Entry
110848322         CDS       T05043                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fcd  Folsomia candida
Pathway
fcd00052  Galactose metabolism
fcd00500  Starch and sucrose metabolism
fcd01100  Metabolic pathways
fcd04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110848322
   00500 Starch and sucrose metabolism
    110848322
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110848322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110848322
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110848322
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110848322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Trefoil
Motif
Other DBs
NCBI-GeneID: 110848322
NCBI-ProteinID: XP_021951199
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MGKIVSKLKSRNSVNEDEREIQKYAEETENRPYEFGLQNTDDLKKITWYQRLIFDLRFRI
AYAIIIAIILGIGVPIAIHQLLYDHEDSTIYGSCLIKTEARFQCLINNAEIANRRQCVDA
NCCWEENDELPFKCYHSFPTADQYRVLEIKQLSENGDAVQITADPNQGWMTRLTILISWL
DEGHLNLQMFNPALYPERVTSGLGDVLPGGPRSIEKDGLIISYPDVGDYFFIQIERVGDG
WNRNETIFDTRLGPINSGNGFMAFTTTLSTPYFYGLTGGEGIASKSTVTFGVMNGFENAE
TPFYMSLENSNSWHGILLETTLPFVTQVLQAPGIGFHIEGPKADINLHFFNGPTTTGVLT
QLHSYLSTRIGNETTSTPEIAPLVPYIPPYWGLGLHLCRSMWDTALVWEHIDELNNATLN
KIPYDSDCIHGNLRNLLVKNSTIFSSEELADIVEMLNVTEKKIVLSQTFTIPFVEGVTDI
SEIGEFLVMNRMNGSSHPFVGMIDNGTVVYPDVFHPTIFSDLAPWNFNFSDIPVSGFILT
DNFPRNENSSSCQKPGSFLQKLLLSTNRSIQIEPNDALKKINPWGSICPQISHTVVQINT
SRVEKTHLELHNSYGLQSSKKIRQVLHSLEGDALSKRDLVLSTSSSWTESLYYGATNGMQ
ANFTWVALRESLAHVVRHFVLSPVTGTTICGAFLPNEKPDFDNNLCLRWYQLGLLLPHAY
HNYAKGNDSRGPLDFPKRYQNYLSEAIRQRYTYAPYYYTLLINYQKTFVPMILPMSYLFH
NVSGVERATVFKLVDQFMIGEAILAAPIVKPELNRESYFPPGIWYDADGFMAWNDTGNGG
FKTVTGYLVQTPLFLRGGYVIPTLQNPEGRSITESRNGNYTLIVTLLPNQKSVGTLLADA
GMSKSVPLTAEIHFEVTTSFTSDEVSINVTISVVDATICDDENIVDMPSTTIDHIKFIGF
PYRFNNYTTTPEDLDPVGGDELDYLRISNIGMNWCEGAVANIYIRASPKQE
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcgtgtcgaaactgaaatccagaaatagtgtaaacgaagacgaacgagaa
atccagaaatatgcggaggaaacagaaaaccgtccgtacgaatttggattacaaaatacc
gatgacctgaagaaaatcacatggtatcaacgattaattttcgacctacgtttccgcatc
gcgtacgccatcataattgcgataattctgggaatcggggtaccaatagcgatccatcaa
cttctatatgaccacgaggactctacaatttatgggagttgcttaattaaaacggaggca
aggtttcagtgtttaataaacaacgccgagatagcaaaccgacgacaatgcgtggacgcg
aattgctgctgggaagaaaatgatgaattaccgtttaaatgttatcactcatttccgacg
gcagatcaatatcgagtcctggaaattaaacagttatccgaaaatggtgacgcggtgcag
ataacggcagatccaaatcaaggctggatgactagactgaccattttgatctcttggctg
gacgagggtcacttaaatttgcaaatgtttaatccagccctttacccggaacgggtaacg
agcggattgggcgatgttttaccgggtgggccgagatcaatcgagaaagatgggcttatc
atcagttatccggatgtgggggattactttttcattcaaattgaacgagttggagatgga
tggaatcgaaatgaaacaattttcgataccagattaggtccaattaacagtgggaatggt
ttcatggctttcaccacgacgctgtcaaccccatacttttatggactcacaggtggggaa
ggaattgcatccaaatcaacggtaactttcggcgtgatgaatggctttgaaaatgcagaa
acgccgttttacatgtcacttgaaaactcaaattcatggcatggaatacttttagaaacc
acacttccatttgtcacacaagttctgcaagcgccaggaatcgggtttcacatcgaaggt
cccaaagccgacattaatttacacttctttaacggacccacaacaactggagtcttgacc
cagcttcattcttacctttctacccgaatcggcaacgaaaccaccagcacccccgaaatt
gccccccttgtcccctacatcccaccctattggggtctcggcctgcacctgtgccgctcc
atgtgggacactgccctcgtttgggagcacatcgacgaactcaacaacgccacccttaac
aaaattccgtacgattctgactgcattcatggaaatttgagaaatcttttggtcaaaaac
agcacaattttctcgtctgaagaacttgccgacattgtcgaaatgttgaatgtgacagaa
aagaagatcgttttgagtcaaacttttaccatcccgtttgtcgagggtgtcacggatatt
tcagaaattggagagtttctcgtgatgaataggatgaacgggtcttcgcacccgtttgtg
gggatgattgataatgggacggtggtttatccggatgtcttccaccccaccattttctct
gatctggccccctggaatttcaactttagcgacatccccgtctctggattcatcctgact
gacaattttccgcggaatgagaattcatcatcctgccaaaaaccgggctccttccttcaa
aaactgctcctctccacgaaccgctcaatccaaatcgagcccaatgacgcccttaaaaag
atcaacccttggggctcaatctgtccccagattagtcacaccgtcgtacagattaatacc
agtcgagttgagaaaactcatttggaactccacaattcgtacggtttacaatcctcgaaa
aaaattcgccaagttttacactccctggaaggcgacgccctcagtaagcgtgacctcgtc
ctgtcaacgtcttcgtcatggacggaatccctctattacggagcgaccaacgggatgcag
gcaaatttcacgtgggtcgccctcagggaaagtttggcccacgtggtgcgacactttgtc
ctttcaccagtcacaggaacgaccatttgtggcgcttttctacccaatgagaagcccgac
tttgacaataatctgtgcctgagatggtaccaacttggactcctgttgccccatgcgtac
cataattatgcaaagggtaacgactcgaggggaccgttagattttccgaagagatatcag
aattacctctcggaagcgattcgccagcggtacacgtacgcgccgtattactacacgctg
ctcatcaattatcagaaaaccttcgtccccatgatcttgccgatgtcgtacttgttccac
aatgtttctggcgtcgagagggccaccgttttcaaattggtggaccaattcatgatcgga
gaagccattcttgccgcgcccattgtgaagccagaactgaatcgcgaatcgtatttccct
cccggaatctggtacgatgctgacggttttatggcgtggaatgacaccggaaatggcgga
ttcaagaccgtgaccggctatttagttcaaactccgctgtttctgagaggtggatatgtc
ataccgactttgcaaaacccggaaggccgttctatcacggaatcgcggaatggtaattac
actctgatcgtgaccctacttccgaaccaaaaaagcgtcgggacgctcttggcggatgcg
ggaatgagcaaatctgtccccctcaccgccgaaatccacttcgaagtcacgacgagtttc
acctcggacgaggtgtccattaacgtaacgatttccgtggttgacgccacaatttgcgac
gacgagaacatcgtcgacatgccgtcgacaacaattgaccacataaaatttatcggattt
ccgtaccgtttcaacaactatactacaaccccggaagatctggatcctgttggaggggac
gagttggactatttgcgaattagtaatattggcatgaattggtgtgaaggtgctgtggcg
aatatttatataagagctagtcctaagcaggagtga

DBGET integrated database retrieval system