KEGG   Folsomia candida: 110848453Help
Entry
110848453         CDS       T05043                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fcd  Folsomia candida
Pathway
fcd03030  DNA replication
fcd03410  Base excision repair
fcd03420  Nucleotide excision repair
fcd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110848453
   03410 Base excision repair
    110848453
   03420 Nucleotide excision repair
    110848453
   03430 Mismatch repair
    110848453
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fcd03032]
    110848453
   03400 DNA repair and recombination proteins [BR:fcd03400]
    110848453
Enzymes [BR:fcd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110848453
    6.5.1.6  DNA ligase (ATP or NAD+)
     110848453
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110848453
DNA replication proteins [BR:fcd03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110848453
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110848453
DNA repair and recombination proteins [BR:fcd03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110848453
   NER (nucleotide excision repair)
    Other NER factors
     110848453
   MMR (mismatch exicision repair)
    Other MMR factors
     110848453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 110848453
NCBI-ProteinID: XP_021951368
LinkDB All DBs
Position
Unknown
AA seq 1012 aa AA seqDB search
MLHCCFLSSRNKIAKLLFSKFQNLRKFGVPRVTLTSTTPTTYFLKCDVNIYYTASCFFST
SFANSAKMHQTKIGQFFKKKESPSSSPVKKPELQIKPRKAKPPSTSDEEVEEEEEVKVKG
RAKKTLWKIGGGESSSSPAGKKRKSKNTSSDEEGIHKKVMAGGSSKKQRKRIVVESSSES
EMEVEEKKEDEEKVEIVEKVEDNDEAVEEVKEADTAKDEKDEEEKEENGKSPKSPSMSSS
EDEKKKDKPKDKKVVDKKAAKKSVEKEDKGKSKKDDKDKSKKDDKSKSKKDDKGKSEEDE
KEKSKKENGASSSSSKVSPSSSAKKDEPKSFFGKPVTTMMGGGANPKGWNDDYDPSKNKY
HPIDDASWKRGEKVPYLALAKTLEAIEATSSRLKFIEILANYFRSVILLSPDDLLMSVYL
CLNKLAPAYEGVELGVAETNVMKAIAQATGRALDRIKSDAATMGDLGLVAENSRSNQRTL
IQPSPLTVAGVFAKLKEIAAMSGQASHAKKIQMITSMLVSCKFSEARYLTRSLLGKLRIG
LAEQSLLQAIAQATFLTPADQDLSEWPPEIIDAGKKMSADTLKAKIEEHAFKIKTCYCEC
PNYDVLIKALREVGVDGLSERCKLTPGVPPRPMLAQPTKGVADVLDRFDGIKFTCEYKYD
GERAQLHFLEDGSIRIYSRNQEDNTSKYPDIITRFNQCIKGDVKSCIIDSEAVAWDIEKE
TILPFQVLSTRKRKDANATEIKVQVCVFAFDLIYLNGESLVTKPLVERRELLRDNFQQVK
GQFTFATSLDTSSTEEVQEFLEESIKGNCEGLMVKTLNERASYELAKRSQKWLKLKKDYM
DSGGDSLDLVVIGGFLGKGKRTGTYGGFLLACYDQSEEAFQTICKIGTGFSDDDLQKHSE
TLKAVVIPNAKSYYRYNQQLVPDHWFDAVQVWEVKCADLSLSPVHTAAEGLADPQRGISL
RFPRFLRIREDKNVEDATSSQQVCDMYKNQEQVKNSDSKKSSKNADDDDGFY
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgctgcattgttgtttcctttcaagcagaaataaaatcgcgaaattattattttctaaa
tttcaaaatttacggaaatttggtgtccccagagtcacacttacctccaccactcccact
acttactttttaaagtgtgacgtgaatatatattatactgcatcgtgtttcttttcgact
tcgtttgctaactcagccaaaatgcatcagaccaagattggacagttctttaagaagaag
gagtccccttcttcgtcccccgttaagaagccagagcttcagataaaaccgagaaaggcg
aagccgcctagcacttcggatgaggaggtggaggaagaagaagaggtcaaggtgaagggg
agggcaaagaagaccttgtggaaaattgggggaggagaatcatcgtcgtcaccagcgggg
aagaagaggaagtcaaagaatacgtcttcggatgaagagggaatccataaaaaagtgatg
gcagggggaagcagtaaaaagcagaggaaacgtatcgtggtagaaagctcaagtgaaagc
gagatggaagtagaagagaagaaggaggacgaggagaaagttgaaatagtggagaaagtt
gaggacaatgatgaagcagttgaagaagtgaaggaggcagatactgctaaagacgagaag
gacgaggaggagaaagaagaaaatggaaaatcgcccaaatcaccatcaatgtcgtcatca
gaggatgagaagaagaaagataagccgaaggataagaaagttgttgataaaaaggccgcc
aagaaatcggttgagaaagaagataagggcaagtctaagaaagatgataaggacaagtcc
aagaaggatgataagagcaagtccaagaaggatgataagggcaagtccgaggaagatgaa
aaggaaaagtccaagaaagaaaatggggccagcagtagcagcagcaaagtttctccttca
agttctgccaaaaaagatgaaccaaagtcattcttcggaaagccagtgaccactatgatg
ggaggaggtgcaaatcccaaggggtggaacgatgactatgatcccagcaagaacaaatat
cacccgattgacgatgcttcgtggaaaaggggtgaaaaggttccttatttggctctggcg
aaaactttggaagctatcgaagcaacgagtagcagactgaaatttatcgaaatcttggca
aattacttccgatctgtgattctcctttctccagatgatctcttgatgagcgtttatctc
tgtctgaataaattggctccagcctacgaaggggttgagcttggggtggcggaaacgaac
gtgatgaaagctattgctcaggcgacaggtcgtgccttggatcggataaagtctgatgca
gccacaatgggggatttgggtttggtcgctgaaaacagtaggtcaaaccaaaggactctt
attcaaccaagtccattaacagtagccggagtgtttgccaaattgaaagagattgcggca
atgtcaggccaagcgtcgcacgccaaaaagattcaaatgatcacatctatgttggtatcg
tgcaagttttctgaagcgagatatttaacaagatcacttcttggtaagttacgaatcgga
cttgcagaacaatctcttcttcaagcgatagctcaggcgacctttttaacccctgcggat
caggacttatcggaatggcccccagaaattattgacgctgggaaaaagatgagtgccgat
acactgaaagctaaaattgaagaacacgccttcaaaattaaaacatgttactgcgagtgc
cccaattacgacgtcttgataaaagctttgagggaagtgggagttgatggactgagcgaa
cgatgcaaattgacccctggagttccccccagaccaatgttggcccaaccaaccaaagga
gtggccgatgttttggatagatttgatggaattaagtttacttgtgaatacaaatatgac
ggggaaagagcccagcttcactttttggaggatgggtcaatccgtatttacagcagaaat
caagaagacaacacgtcaaaatatccggacattattacccggttcaaccagtgtattaaa
ggagatgtgaaatcttgcataatcgattccgaagcagtcgcgtgggacattgaaaaggaa
acaattttgccattccaagtgctttccactcgtaaacgaaaggatgcgaatgcaactgaa
atcaaagtgcaagtttgtgtatttgcctttgacctgatatatctaaacggagaatctttg
gttacaaaacctctcgtcgaacgtcgtgagcttctgagagataacttccaacaagttaaa
ggacagttcacatttgcgactagtttggacactagtagtactgaagaagtgcaggagttt
ttagaagagtccatcaaaggaaattgcgaaggactgatggtaaaaacattgaatgaacgt
gcatcatacgaacttgccaaacgctcgcaaaaatggttaaagttgaagaaggattacatg
gattctggtggtgactctctcgatttggtcgttatcggaggattccttgggaaagggaaa
cgaaccgggacatatggcggatttctcctggcttgttatgatcaaagcgaagaagcgttt
caaactatttgcaagattggaaccggcttttctgatgatgatctccaaaaacattcagaa
accctcaaagccgttgtgattccaaatgcaaaatcatactaccgatacaaccaacaactc
gtgccggatcactggtttgatgctgtacaagtttgggaagttaaatgtgctgatttatct
ctctctcctgtccacactgctgctgaaggattggctgacccccagcgtggaatttctctt
cgttttccaagattcctgcgaatccgcgaggacaagaacgttgaagatgcaactagctct
caacaagtatgtgacatgtacaagaaccaggagcaagttaaaaactcggacagcaaaaaa
agtagcaagaatgctgatgatgatgatggattttactga

DBGET integrated database retrieval system