KEGG   Folsomia candida: 110849774Help
Entry
110849774         CDS       T05043                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fcd  Folsomia candida
Pathway
fcd00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110849774
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110849774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 FAD_oxidored EF-hand_6 GIDA EF-hand_8 Pyr_redox_2 EF-hand_9 EF-hand_5 HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 110849774
NCBI-ProteinID: XP_021952915
LinkDB All DBs
Position
Unknown
AA seq 726 aa AA seqDB search
MSFGRNLRRFIGYGSAIGGGYFVATWMMQEPTSAWAPVSMDLNHLNVRPKRPLPTRAEQL
KSLQSDEFDVLVIGGGATGSGCALDATTRGLKTALVELDDFASGTSSRSTKLIHGGVRYL
QKAIMGFDIEQYRMVKEALHERANLLQIAPHLAYPLPIMLPVYRWYLVPYYWAGIKAYDF
VAGGKRVKPSYYLSKERALELFPMLRKDKLCGALVYYDGQQNDARMNLSIALTATRLGAT
IANHVKVLDLVKERDEEGIQRIVGAKLHDEISGKEFNVRAKCVINATGPFTDQIRKMDDQ
KVSDICCPSSGVHIVLPGYYSPEEMGLLDPDTSDGRVIFFLPWQKLTIAGTTDTPCDVTR
SPAPTEKDISFILHEVKHYLNPDLEVRRGDVLSAWSGIRPLVSDPNKPDTQSLARNHIVH
VSPGGLVTIAGGKWTTYRSMAVDAVDAAVQACKLQPTSPSQTDGLLLEGAHGWSPTLYIR
LVQDMGLEPEVAKHLANTYGDRAFSVAKLSALTGKRYPVVGKRLHTEFPYVDAEVRYAVK
EYAATAVDVIARRTRLAFLNAQASVEALDTVVDIMAEELKWSPAEKKRQQDMAIEFIQTE
MGMGVSEKTRAEAITVELTNLEREIYTKRFQSIDQEKKGFITINDIRRSLKNQGEDVPGE
VLHSILKELDTNRNGQVEIEEYLAMMSAIKSGAVVNSRFARMAEMEEERLRLLRTKITVD
RSGGGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttggacgaaatttacggcggttcataggctatggctcggccattgggggcggc
tactttgtcgcgacttggatgatgcaggaaccaactagtgcatgggctcccgtctcgatg
gacctgaaccatttgaacgttcggcctaagcgaccacttccaacgagagcagaacagtta
aagtccctccagtcggacgagtttgacgtgttggtgattggcgggggtgcgacggggagc
ggttgtgcattagacgccacgacccgaggccttaaaacggcactggttgagttggatgat
tttgcatctggcacaagcagccgatccaccaaattgatccatggcggagtccgatacctc
caaaaagccattatggggttcgacattgagcagtatcgcatggtaaaggaagctttgcat
gaacgagcaaatttgcttcaaattgctccacacctggcctacccacttcccattatgctt
ccagtttatagatggtacctcgtgccctattattgggcagggattaaggcctatgacttt
gtagcaggcggaaaacgagtcaagccgtcctactatctgtcaaaagagagagccttggag
ctttttcccatgttgcggaaagataaattgtgtggagctttggtttactacgacggtcaa
caaaacgatgccaggatgaacttgtcgattgctctaactgcgacgcgtctcggagccact
attgcaaaccacgtgaaagtattagatttagtcaaagaacgggatgaggaaggaattcag
cgtattgtaggtgccaagttgcatgacgaaatttcaggaaaggagtttaatgtgcgagcg
aagtgtgtcatcaacgcgacgggcccatttacagatcaaatcaggaaaatggacgaccaa
aaagtgtccgatatctgctgcccctcttcaggcgtgcatattgtgcttcccggctattac
agccctgaagagatgggacttcttgatcccgatacttccgacgggagagttattttcttc
cttccgtggcagaagctcacaatcgcaggaacaaccgataccccctgcgacgtgacacgc
agtcctgcccccacagaaaaagatatatctttcatccttcacgaagtaaaacactatctc
aaccctgacttggaagtccgtcgaggcgacgttttgtctgcttggagtgggattagacca
ttggtgagtgacccaaacaaaccagatactcaatctctggcccgaaatcacattgtccat
gtcagccctggtggtttagttaccatcgctggtgggaaatggaccacttacaggtccatg
gccgtcgatgcagtagatgctgcagttcaagcttgcaaactacagccaaccagccccagt
caaacggatggacttcttctcgaaggtgctcatggatggtctcccactctgtatattcgt
ttggtccaggacatgggtctagaaccggaagtagcgaaacatttggcaaacacttacggg
gatcgagctttctctgtggcaaaattgtctgctctcactggaaaacgatatccagtagtt
gggaagcgtcttcatactgaatttccttatgtggacgcagaggttcgctatgccgtgaaa
gagtatgcggcaactgccgtcgacgtcattgctagaaggacacgtttggcatttttgaat
gctcaggcatccgttgaagcattggacacggtggttgatatcatggcagaggagctcaaa
tggtcacctgccgagaaaaaaaggcaacaagacatggcgattgaatttatccaaactgag
atggggatgggagtgagcgaaaagactcgagcggaggccatcacggttgaattgactaat
ttggaacgcgaaatttatacaaagcggttccaatccatagatcaagagaagaaaggattc
atcaccattaatgacattcgcagaagtttgaagaatcaaggggaagatgtgccgggtgag
gtactgcattctatcctaaaagagctggatacgaatcggaatggtcaggttgagatcgag
gaataccttgctatgatgtctgctataaaatcgggtgctgttgttaactcaagatttgca
agaatggcagaaatggaagaggagagactgcgattgctcagaacaaagataaccgtcgat
cggtctggaggagggctttaa

DBGET integrated database retrieval system