KEGG   Folsomia candida: 110852866Help
Entry
110852866         CDS       T05043                                 

Definition
(RefSeq) hexokinase type 2-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fcd  Folsomia candida
Pathway
fcd00010  Glycolysis / Gluconeogenesis
fcd00051  Fructose and mannose metabolism
fcd00052  Galactose metabolism
fcd00500  Starch and sucrose metabolism
fcd00520  Amino sugar and nucleotide sugar metabolism
fcd01100  Metabolic pathways
fcd01200  Carbon metabolism
Module
fcd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fcd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110852866
   00051 Fructose and mannose metabolism
    110852866
   00052 Galactose metabolism
    110852866
   00500 Starch and sucrose metabolism
    110852866
   00520 Amino sugar and nucleotide sugar metabolism
    110852866
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110852866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110852866
Enzymes [BR:fcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110852866
Membrane trafficking [BR:fcd04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110852866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110852866
NCBI-ProteinID: XP_021956692
LinkDB All DBs
Position
Unknown
AA seq 452 aa AA seqDB search
MSVPEKVVQVCEELIISDETLRRVMDALDHEINLGLGKETNSSATVKCFPTYVRCLPNGQ
EKGKFLALDLGGTNFRVLLIDLEGGSTTAKMVSKIYAVPTAVMVGPGDGLFDHIAQCLST
FMHEHKVENVKIPLGFTFSFPCRQEGLTKGILVTWTKGFNCSGVEGKDVVLMLQEAIRRR
GDVEIDVLAVLNDTTGTLMACAYKNQDCRIGLIIGTGTNACYIEKLDKVELWNEDHNEPK
QVIINTEWGAFGDNKCLDFIYTGYDREVDETSINPGKQIFEKMISGMYMGDIAGLVLRKL
TREGHIFRGNGADEIFKRGAFHTKYISEIEGDKVGDWTNCRQILLEELGIPEPVTDQDCI
VVRHVCEVVSRRAAHLVSAGLACLLNKIGEKKAVVAVDGSVYRFHPCFHNLMTAAIQKLV
NPDMKFDLMLSEDGSGRGAALVAAVASRTASD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcccgagaaagtggtgcaagtttgcgaggagttgatcatttcggatgagacg
ctccgtcgcgtgatggacgcgttggaccacgagatcaatctcggtctcggcaaggagacg
aattcctcggcgaccgtgaagtgcttcccgacatacgtccgctgcctccctaatgggcaa
gagaaaggcaaatttctcgccctggacctcggcgggacgaattttcgtgttctactgatc
gatctggagggaggaagtacaacggcgaagatggtttccaagatttacgccgtccccaca
gcggtcatggtgggaccgggagacggactttttgaccatattgctcaatgcctatcaacc
ttcatgcatgaacataaagtggagaatgtcaagattccgctgggctttacgttctcgttt
ccttgcaggcaggaaggattgacgaaggggattctggtcacgtggacgaagggatttaat
tgttcgggggtggaagggaaggacgtcgtcctcatgttgcaagaggcaattcgtcgcagg
ggggatgtcgaaattgatgtgttggcagttttgaatgacacgacgggaactctgatggca
tgtgcgtacaagaaccaagactgtcgaattggacttatcattggaacgggtacgaatgcc
tgttatatcgaaaaattggacaaggtcgaactctggaatgaggatcataacgagccaaag
caagtgattatcaataccgaatggggcgccttcggagacaacaaatgcctagactttatc
tacaccgggtacgatcgagaagtggacgagacatcgatcaaccctgggaaacagatattc
gaaaaaatgatttccgggatgtatatgggagacatagctggcctagttctcagaaagttg
acccgtgagggtcacatcttccggggaaatggtgcggacgagattttcaagcgaggagct
tttcacaccaagtacatctcagagattgaaggggacaaggtcggcgactggacaaattgt
cgtcagatcctcctcgaggaactcggcatccccgaacccgtcacagatcaagactgcatc
gttgttcgccacgtgtgcgaggttgtctcgcgtcgtgccgcccacctcgtctccgccggt
ttggcctgcctcctcaacaagattggggaaaagaaggccgtcgtggcggtggatgggtcg
gtgtaccgtttccacccctgtttccacaacctgatgactgccgcgattcaaaagctggtc
aatcccgatatgaagttcgatctgatgttgtccgaggacgggagtgggcgaggagctgcc
ttggtcgctgctgtggcgtcgagaacggcgtcagattga

DBGET integrated database retrieval system