KEGG   Folsomia candida: 110854152
Entry
110854152         CDS       T05043                                 

Definition
(RefSeq) trithorax group protein osa-like
  KO
K11653  AT-rich interactive domain-containing protein 1
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fcd03021]
    110854152
   03036 Chromosome and associated proteins [BR:fcd03036]
    110854152
Transcription machinery [BR:fcd03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     110854152
Chromosome and associated proteins [BR:fcd03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    110854152
SSDB
Motif
Pfam: BAF250_C ARID
Other DBs
NCBI-GeneID: 110854152
NCBI-ProteinID: XP_021958245
LinkDB
Position
Unknown
AA seq 2596 aa
MATVGQAETPTNNTNSKVNNCDSSGINNSSGSSGSKLVNGSANDPDFSSPENNNAMKEGY
RYNHAPPGPYDHHNRLNQNSHHPDQQQKGVVGGGMDGQQQQQEYPPPPPHQQQYQQYPPY
RAQQSYDQQPPPHHNNGPESYQQHQQQQQQHPGYPQPMRYPGKPMPGPGGAPGPNVSGLP
QPHGYPPGPGGMRPNYPGGGGMGGGVPGQQSISQQPSGQTPTLNQLLQSPGGANAGASGS
TGGHRYPPPPAGYEHGSYPQNPPNHAKADYSQQGPTGWPPANRPPPNSYAHPPPPPFQQQ
PQQPMYRQNAPGAGSRGGGPPQQPVSGPPPQQQQQQQHQNYYQQQQQQGPHHPGYPPPPP
QSPHYPPPPHSQQRYPSPGPGMRPPDNQPHYPPQHAPGMAPPDAGNGGSEPPKSTPPPPP
SPSLANHGQNPPSPQQSPRPTPHPPPVSSSNSNSLPPPNSPSHRPQGSSPSNSYPAPDVG
EVTGCNSNDSVGGMNQQQPCGPRPSPSPTGSAGSRSMSPAVGNQNIPMPPRPSSSQSDGG
SYPGQAMAPPPHHMPYQSGGKLAHQAGMVPPPSQGGGAGHYPHQQPNPQQQHWQHQQQQG
QQGPGGGYGPRGPPPPQQHGGHVGGMMSPYPPPVQQPMQANNYGGPRHPMPNHVGGGPPP
PQQQGPGGGNQYNSPYPPHYPSQPPPQGWPGAVAGSNPLGTPPPPRSQLHLKQQLQHKLG
YPTHGYPMGPPGPSSPSQTPPPPHSHHPGIMPGDSQDGGISNPPNLVSVGPDGANVDEVS
QQSTLSNASGASGGDDGPPMPKLRPEGPRPHQNYPSHPTTPQNNAVPSPGAASMNSVHEE
YGEMNSPGWPRTPASPKADSLNKLYDMDENPDRRLFLDKLIHFMEENNTPIASCPTISKN
PLDLFRLYLFVKERGGFLEVSKNKTWKDIAGSLGIGASSSAAYTLRKHYTKHLFPFECKF
DRGGIDPQPLINQVETSTKKKGKTTAPVPSPGSSNSQDSFPGINNNNTNSSSMDGFNSPP
SSNYPTYGQPPSGGEYGGAPGSSGPTPSPLARPPGPPGQNSQQPPQHPDRDKSQVSVSNP
FDDQYPQHYQQQSRPNYYPPYSSQPPSGYQGGPPGNYPPYPSPVEQQYPGRPPGPLVDGY
SGGVQPQGGYGRSMYPPYGGGEGSGPTPQGPGGYSGQPPLPPQSGSQGQHPPNSQNSTSG
SEDRYNMAPPSSTQGGGGGSGPPQGYPPRGPYPPSSSASQQGPPGSSPVGQQPGGPHPPP
PPNGYPSQQDYYNSQSQTEQGYPPGGKHMPPPHPNQGMRYPPGKEGGAQAQQYPGYPSPA
QGPQQRVPPYDGQPGSNSRVGFTPPPPRSSPSPSPNVPPAPSPTAPAQKPWNAPEGWPNS
GGHYPGQQRGYPPPPPGPQGASPSPHTPPQGATPVPAQSPGSTPPQQPISPQPWAGSSAG
GPGGRPGPPNSNAQQGPPPPPQGATWPQQQDPRYSSSSATGSSIMSPPVSGSSSHSHSSQ
PSPWPTSSASGPSRSSGGGRSPFPSSGGKPGPEMFNRGYGPSPSSGLQPSPSAGPSKGPM
GPPGMSPQQQQQQQQQQLGGHPGQGYPPHSVPMLPGGQVKREIIFPPESVEAVTPVLSRR
RKLHKSDVSPVEAWRIMMSLKSGLLAEVTWALDVLNVLLYDDQSVSYFSLTYLPGLLDIL
LEHLRRALILLFGQSVGIDLTADKFEEDVGKPIKQLQWYERDDKVVEEEPDLGTPIKSFP
RDSHRTLLLQGSVNYTMVSRFKGKKVRILSRDDEPFIIPGPRDWDVDEKMRNDPDIEQLN
GTMDVSKHIVTYFNTTLPTPLSIVRDIKAEDRRKEKCNNESNNLSSNGGKLPEVGLEFYR
CETKMPTLVTPVSTSTSTPSSSSPSNETSSSLTVTNNSSSSSNHPVVTPINSSTTSNTKK
IIQENGPLNSENALDMTMEKKNNCQLFSTPTSNLLPNSKINSIVHQKKKRLDDVLGRIRK
EQTEDDNALSESPIIPSAAVADTENAETVVVKKERHHDHIDDELAVVNNNNSATVVEKRL
PVLENGLSDSNNLIMMGGGSDNSNLSAANSENTCDSSKHFKHVVDVKIGDITIRDPGAAL
KRKRVEDYEDECYSRDESSLYLVTESQDSLSRRCLSICNIIRNLTFVPGNEVEFGKCTSF
LSLVGKLILLQHEHPVKKAKPSSPSSSKPSSKTSTETDEVEKESSEHQEKQPKEKKDEDN
NKEDEKIVTKEPTSESAEDESSEPKSTTNNEETADEQMQVDEQHDKEEAEEKKKVEKAKE
KDDQVEEVEEDEEEEALFAEEEEPEPSGSAAVIEIEADSCTSLTNDDEWWWDYVHHIREH
VLVMISNISGQMDLSQFSEEVSRPILDGLLHWAVCPAAYGQDPFPTLSPGAYLSPQRLAI
EALVKLSVIQGNVDLLLATPPYSRIERLCQLLCRSLCRTEEQVMREFALNLLYYLSAADS
GVARTIALQNPCISLLISFIEQAEHNAMNIANNHGFSVLRENPEAMGTSLDMLRRAAMTL
LNLARHPDNRPLFVQHEPRLLQLVMSQILEQKVAAMVAQVLYQCSTPDATCSQKYLYASN
MDTFYTPLFSRSKPTY
NT seq 7791 nt   +upstreamnt  +downstreamnt
atggccacggttggtcaggcggagacgccgacgaataacacaaatagtaaagtgaataat
tgtgatagcagtggcatcaataatagtagtggtagtagtgggtcaaaattggtgaatggg
tcggcaaacgacccggacttttcttcaccagagaacaacaatgccatgaaagaggggtat
cggtacaaccacgctccccccggaccctacgaccaccataatagattaaatcaaaacagt
caccatcccgatcagcagcaaaaaggggttgtaggtggagggatggacggtcagcagcag
caacaagaatatcccccaccgccgccacaccagcaacagtatcagcagtatccgccttac
agggcgcagcaaagttacgaccaacaacctccaccccatcataataatggtcctgagagt
tatcaacagcaccagcagcaacagcaacaacatccagggtaccctcaacccatgcggtat
cccggtaaacctatgcccggtccaggaggagcacctggaccaaatgtgtctggtctaccc
caacctcacggttatccacccggacctgggggtatgagaccaaactaccctggtggggga
ggaatgggtggcggtgttccaggtcaacaaagcatatcgcagcagccgagtgggcaaacc
cccactttaaatcaactccttcagtcgcctggcggtgctaatgctggtgctagtggttct
actggaggtcacagatatccaccccctccagcaggctatgaacacggcagttatcctcaa
aaccctcccaatcatgcaaaggctgactactctcaacaaggaccaacgggctggcccccc
gcaaatagaccgccccctaattcttatgctcatccgccacccccaccctttcaacaacaa
ccccaacaacctatgtatagacagaatgctccaggtgcgggaagtagaggcggtgggcca
ccccaacaacctgtctctggacctcctccccagcagcagcagcagcaacaacatcaaaac
tattaccaacaacagcagcagcagggtcctcaccatcccggctacccacctcctccccct
cagtccccccactacccgcctcctcctcactcgcagcagcgttatcctagcccaggcccg
gggatgagaccgcccgataatcaacctcactaccctcctcaacacgcccccggtatggcg
cctcctgatgcaggcaatggaggctcggaaccaccaaagtcaacaccccctccccctccg
tcgccatcacttgccaatcatggtcagaatcctccatcgcctcaacaatcacctcgccca
acgccacatccgccacccgtttcgtcctctaattccaatagtttaccacctcctaattct
ccgtcacatcgacctcagggctcaagtccttccaatagttatcctgctcctgatgtcggg
gaagtcacaggttgtaatagcaatgatagtgttggtgggatgaaccaacagcaaccctgc
ggaccaagaccttctccgtctccaaccggatcggccggatctcgttctatgtcaccggct
gtgggaaatcaaaacattccgatgccaccaagaccttctagtagtcaatcagacggtggt
tcctatcctggtcaagcaatggcacctccgccgcatcatatgccgtaccaaagtggtgga
aaacttgcgcatcaagctggaatggttcctcccccttcgcaaggaggaggagcaggacat
tacccccatcaacaacctaatcctcaacaacagcattggcaacatcaacagcaacaaggc
cagcaagggccaggaggaggttacgggccccgtggcccaccaccacctcagcaacatgga
ggtcacgtaggaggaatgatgagtccgtaccctccacctgttcaacaacccatgcaagct
aataattacggtggtccgagacatccaatgccaaaccatgtgggaggaggacctccgcca
ccacagcaacagggtccaggaggagggaatcaatataatagtccataccctcctcattac
ccttcacaaccacccccacaaggatggccaggtgcagtagcaggttcaaacccactagga
acaccccctcctcccagatctcagttgcatctcaagcaacagttacaacataaacttggc
taccctactcacggctatcccatgggacccccaggaccatcttcaccttcgcaaacccca
ccaccaccacattctcatcacccaggaattatgccgggtgattctcaagatggtggaatc
agcaatccaccaaatcttgtgtcggttgggcctgatggagctaatgtggatgaagtatct
caacaatctacactgtccaatgcatcaggagcatccggcggcgacgatggacctccaatg
ccaaaactaaggccagaaggaccaagacctcatcaaaattatccaagtcatccaacgaca
ccgcaaaataacgcagttccttctcctggtgctgccagtatgaattcagttcacgaagaa
tatggggaaatgaatagtcctggttggccacgaactcctgcgagtcctaaggcggatagt
ctcaacaaattatacgacatggatgagaatccagatcgaagactttttctagataagttg
atacacttcatggaggagaacaatacaccaattgcttcgtgtccaaccatctccaagaac
ccactggatctcttcagactttatttatttgttaaagagaggggtggatttctcgaggtc
tctaaaaataagacttggaaggacattgccggttctttaggaataggagcgtcgtctagt
gcagcctacactttaaggaaacattataccaaacacttgttccctttcgagtgcaagttt
gacaggggtggaattgatcctcagcctttgattaatcaagttgaaacctctacaaagaaa
aagggaaagacaactgctccagttccttcgcccggatcttccaattctcaagattcattc
cctggaataaataataacaatacaaattcgtcgtcaatggatgggttcaattctccacct
tcttccaactatcccacatatggacaacccccttccggcggagaatatggtggcgctcct
ggaagttctggtcctacaccaagcccacttgcacgaccacctggtcctcctggtcagaat
tcgcaacaacctcctcagcatccagatcgtgataagagtcaagtcagtgtgtcaaatcca
tttgatgaccaatatcctcagcattatcaacaacaatctaggcccaattattatcctccg
tattcatctcaaccaccttctgggtaccaaggtggacctccaggaaattatcccccttac
ccatccccagtagagcagcagtaccctggtcgccctcctggtccactcgtagatggatat
tctgggggtgtccaaccacaaggtgggtacggacgctcaatgtatcctccttacggtggc
ggcgaagggtcaggccctactcctcaaggtccaggtggttatagtggtcagccacctctt
ccaccccagtccgggtcgcaagggcaacatcctcctaactctcagaattcaaccagtgga
agtgaagatagatacaatatggctccaccctcttcaacgcaaggtggtggtggtggtagc
ggtcctccccaaggttatcctccaaggggtccgtatcctccttcgtcgagtgcaagtcaa
caaggtccgccaggatcctctcctgttggacaacagccaggtggacctcatcctccacct
cctcctaatggttatccgagtcaacaagactattacaattcccaatcacagactgaacag
ggttatccacctggaggaaaacatatgcctccaccacatccaaatcaaggaatgcgatat
cctccggggaaagaggggggtgctcaggctcagcagtatcctggttacccgtcacccgct
caaggtcctcagcaaagagttccgccctacgacggtcagccagggtctaacagcagggtt
ggttttacaccacccccgccacgttcatccccttccccatcccccaacgttcctcctgca
ccatcacccaccgcacctgcacaaaagccctggaacgctcccgaaggttggccaaacagt
ggaggtcactacccagggcaacaacgaggttaccctcctcctcctcctggccctcagggc
gcgtctccatctccacacactcccccacaaggagcaactccagtccctgctcaaagtccc
ggttcaactccaccacaacaacccatttcaccacaaccttgggctggatcctctgctgga
gggcctggaggaagacctggtcctccaaattcaaatgctcaacaaggaccccctccacct
cctcaaggagcaacatggccgcaacaacaagacccaagatattcctcatcctctgctact
ggaagcagtattatgtctccgccagtttccggttccagttctcatagtcactcctctcaa
ccctcaccttggccaacttcgagcgcatcaggcccatcccgctcatcgggaggtggtcga
tcaccattcccttcgtcaggaggaaaacctggaccagaaatgtttaatagaggatacggt
ccgtcaccatcgtctggccttcaaccgtctccctccgctggaccttcaaaaggaccaatg
ggacctcctggcatgagtccacaacagcagcagcagcagcaacaacaacagttaggggga
catcctggacaaggatatccacctcattcagtcccaatgcttcctggtggtcaagtaaaa
cgggagattattttccctcctgaaagtgttgaagcagtgactccagtgcttagtaggaga
aggaaattgcacaagagtgatgtgtctccagttgaggcttggagaataatgatgagttta
aaatcgggacttttagcagaagtaacgtgggctcttgatgtgctcaatgttctactttac
gatgaccagtcagtatcatacttttccctgacgtacttgccgggattgttggatatttta
ttggaacacttacgacgagccctcatccttctatttggacaaagtgttggaattgattta
actgctgataagtttgaagaagatgtaggaaagccaattaaacaacttcagtggtatgaa
agagacgacaaagttgttgaggaagaaccagatcttggaactcccattaaatcgtttcct
cgtgatagccatcgcactttattacttcaaggctcagtcaactacaccatggttagccga
tttaagggaaagaaagtgagaatcctgtcacgggacgatgaacccttcattattcctgga
ccaagagattgggatgttgacgaaaagatgcgaaacgatcccgatatagaacaacttaat
ggaactatggacgtttccaaacatatagtcacctatttcaacaccacgcttccaactccg
ctctcaatagttcgcgatataaaagctgaagacagaagaaaagaaaagtgcaacaatgaa
tccaacaatttatcatctaatggcggtaaattgccagaagtgggattagaattttaccgt
tgtgaaactaaaatgccaactttagttacgcctgtatcgacatccacttcaacaccatcg
tcgtcatcaccttcaaatgagacgtcgtcgtcattgactgtgaccaataatagttcatcc
agttctaatcatcctgttgtaacacccattaattcatcaactactagtaatacaaagaaa
attatccaggaaaatggacctctcaactctgagaacgctttggatatgactatggaaaag
aaaaataattgtcaacttttttccactccaacttcaaatttattaccaaattcgaagatc
aatagtatcgtccaccagaagaagaaacgacttgatgatgttttaggacgtattaggaaa
gaacaaactgaggatgacaatgctctaagtgaatcaccaataattccatcggcagcagta
gcagacactgaaaacgctgaaactgttgtcgtgaagaaagaacgtcatcacgatcatatc
gacgatgaacttgctgttgttaataataataatagtgctacagttgtcgagaaacgccta
ccagtgctggaaaatggtttgagtgatagtaacaacctcatcatgatgggaggaggtagt
gacaactccaacttgtcggcagctaattcagaaaatacctgtgatagtagtaaacatttt
aagcatgtggtggacgtgaaaataggtgacattactataagagatcctggcgccgcattg
aaaaggaagcgggttgaagattacgaagacgagtgttattccagagatgaatccagtttg
tatctcgtgacggaatcgcaagattcgttatccagacgatgcctatccatctgtaacatt
attagaaatttaacttttgttcctggaaatgaagtagagtttggaaaatgcacatcattc
ctcagccttgttgggaaattaattctcctccaacatgagcatcctgtaaagaaagcgaaa
cctagttcaccttcttcttccaagccgtcgtcgaaaacatctactgaaaccgatgaggta
gaaaaagaatcttctgagcatcaagaaaaacagccaaaggagaaaaaggacgaagacaac
aacaaggaggacgagaagattgttacgaaagagccaacatccgaatctgcagaggatgaa
tcttctgaacctaaatctaccacgaataacgaagagacggcggacgagcaaatgcaagtt
gatgaacaacatgacaaggaagaggcagaggagaagaagaaggtggagaaagcgaaagaa
aaagacgaccaagttgaggaggtggaggaggacgaagaggaggaagcattgttcgcagaa
gaagaagaaccagaaccttctgggtccgctgcagtgattgaaattgaagctgattcttgc
accagtcttacgaacgatgatgagtggtggtgggactatgttcatcacatacgagaacat
gtacttgttatgatttcaaacatctctggacaaatggacctcagtcaattttccgaagaa
gtcagtaggcccatacttgacggacttttacactgggcagtgtgtccagcagcgtatggt
caagaccctttcccaacacttagtcctggcgcatatctctcgccacaacgccttgccatc
gaagccctcgtaaagttgagtgtcattcaaggaaatgtggatttattactggctacacca
ccttattcaagaatagaaagactgtgccaactcctttgtcgctctctatgtcgaacagaa
gagcaagttatgagggagtttgctctgaatctcctgtattatttgtctgcggcggattct
ggcgtagctagaacaattgctttgcaaaatccatgtatatccttactcatatcattcatt
gaacaggctgagcacaacgctatgaatatcgcaaacaaccatggattttctgtgctccgc
gagaatccggaagcaatgggaacttccctggacatgttgcgacgtgcggcgatgactctt
ttaaatctggctcgacatccagacaaccgtcctctctttgttcagcatgaaccacgcctc
cttcaactcgtaatgagtcaaattttagagcaaaaagtagctgcaatggtcgcccaagtt
ctctaccagtgttcaacccccgatgctacctgctctcaaaaatacctctatgcttcaaat
atggatactttctacactcccttattttctcgttcaaaaccgacttactaa

DBGET integrated database retrieval system