KEGG   Folsomia candida: 110855368Help
Entry
110855368         CDS       T05043                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
Organism
fcd  Folsomia candida
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110855368
NCBI-ProteinID: XP_021959489
LinkDB All DBs
Position
Unknown
AA seq 951 aa AA seqDB search
MTTRLYVALFLAAFACPGFAQVPEGYGCMEGNLPNEVRQDCHPEPGASEQICRARGCVWC
GPDPSADGQNFPHCFYRNPFYVAPGPSCDVGYVQPALRVDCTDGTEPMGEMGCRYRNCTW
CPDVPGSMYPPCFTSAAVDDTGYAMVGEPVQTPGGISFTITKSLISPQFENQFTTLNFEA
TFQSDYRLRIKISPSDTQRFEVPIQIDPPAGSNANLLYDVTFTRSPFSFRVVRKSSGAVL
FDTSAGKFQFADQFITMSWRLPTENVYGLGENEQRSFKHDFAERLKYTLYASDQAPYFTS
SLYGTHPVYTVIENGGNTHMVAIINSNAQEFHLLPGPSMKYITIGGLIDMYFFLGPTPDQ
TVQQFTEAVGRSQMPAYWSLGFQLCRWGYDNITNMKAAVDRTEFYQIPHDVQYGDIDIMR
DELDFTYSEVNFPGLPAYIEELKGKGIKFITILDPAISTIDADYEPYTLGTEMDVWIKRQ
DGTPMTGHVWPYGATAPCHFPDYAKNSTREWWIYLVDKFHDLLAYDGLWIDMNEPANFDN
GDIQGCANNTWNYPPYQPKTDANKADMHFKTLCGDHVDSVSIHYNTHSLYGWFESEPTLI
GARSGTGKRSLVLSRSTFIGSQRWASHWLGDNWSHWSNLHFSIIGVMQFNLWGMPYVGPD
TCGFIGNSNAAMCQRWGELGAFYPFSRNHNVRDTIDQDPGAWGAQVAASTKAALEVRYTL
LPYLYTLFYHHVSSGTAVFRPLWYNHQDDSRTYPIDRQFMWGAGLLISPVLTEATTWVTA
YFPNSRHFSYYTGDEIPVRGNTLNMTAPLDFIHVHVVGGNVLPTQEPARNTEAARLNPLG
VIVALDDGGSAVGDLFYDDGDSIDTHLTGAYFHAVYTMSSGTLTSTVVHDGYPEMGTKTL
NTIRLMGLTTPATSVTVNGVSHTDFENLESGEVLVRNLNLVANSAFTVVFA
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcgtctttacgtagctctgtttctggcagcttttgcttgcccagggttcgcc
caagtaccggaaggttatggctgtatggagggcaacttaccgaacgaagtgagacaagat
tgccaccctgagccgggcgcgagtgagcagatatgtcgggccagggggtgtgtctggtgt
ggtcctgatcccagcgcggatggacaaaatttcccacattgcttttatcggaatccattc
tatgttgcacccggtccgagttgtgacgttggttacgttcaacccgcccttcgggtcgat
tgtaccgatggaaccgagccgatgggtgagatgggatgtcgctacagaaattgcacatgg
tgcccggatgttcccggatcgatgtatccgccgtgtttcacttccgccgctgtagacgac
acgggttacgcgatggtcggtgaacccgtccaaaccccaggtggtatcagctttaccatt
acgaaatccttaatctcgccgcaatttgaaaaccagttcaccacgcttaacttcgaggcc
acattccagtccgattaccgactcaggattaagataagcccctcagacacgcaacgattc
gaagtccccatccagattgatccgccggcagggtcgaatgccaacctcttgtacgacgtg
accttcacccggtccccattttcctttcgggttgtccggaaatccagcggcgccgtgcta
ttcgacacgtccgcgggaaaattccaatttgccgaccagttcatcacgatgagttggagg
ttaccgacagaaaacgtgtacggtttgggggaaaatgagcagcgaagttttaaacatgat
ttcgccgaaagattgaagtacacgctgtacgcgtcggatcaggctccctatttcacttcc
tccctctacggaacccatcccgtttacacagtaattgaaaacggcggaaacacgcacatg
gtcgccattattaacagcaatgctcaagaatttcatctgcttcccggcccctcgatgaaa
tatattacgatcggtggcttaatcgacatgtactttttcctcggaccaacgcctgaccag
acagtccaacaatttacggaggcggtcggtcgttcccaaatgccggcctactggtccctc
ggcttccaactttgtcgctggggttacgacaacatcacaaacatgaaagcggccgttgac
cggactgaattttaccaaattccacatgacgtccaatatggcgatatcgacatcatgcgc
gacgaacttgattttacttactctgaagtcaattttcccgggcttcccgcctacatcgaa
gaacttaaaggaaagggcatcaaattcataacgattcttgatcccgccatttctactatt
gatgcggactacgaaccctacactttagggacggagatggatgtatggataaaaaggcag
gatggaactccgatgactggccatgtttggccgtacggcgccacggcaccttgtcatttc
ccggattacgcaaaaaattcaacgcgcgaatggtggatctatttggtggacaagtttcac
gatttgctcgcttacgatggcctgtggattgatatgaatgagccggccaattttgataat
ggagatatccaggggtgtgcgaacaacacgtggaactacccgccatatcagccaaaaacc
gacgcgaacaaggcggacatgcactttaaaactttatgcggtgaccacgtggactcggtt
tcgatccattataacacccactccttgtacgggtggttcgagtcggagccaactttaatt
ggagccagaagcggtaccggaaaacggtccctggtcctgtcacgttccactttcatcggt
tcgcagcgatgggcaagtcactggctgggggacaactggtcgcactggtcaaacctccac
tttagcattattggcgttatgcagttcaatttgtggggcatgccttatgttggtcctgac
acgtgtggttttattggaaactcgaacgctgccatgtgtcaaaggtggggcgagttggga
gctttctatcccttctcgaggaatcataacgtacgagataccattgaccaagaccccggc
gcgtggggtgctcaggttgccgcctctacaaaagcggcgcttgaagtgcgttacaccctt
ttgccatatctgtacaccctcttctaccaccacgtctccagcggcacggcggtcttccgc
cctctctggtacaaccaccaagacgattcgaggacctatccgatcgaccgccaattcatg
tggggagcgggactcctaatttctcccgttttaaccgaggccaccacctgggttactgcc
tacttccctaattcccgccatttctcgtactatactggtgacgagattccagtccgcggg
aacacgttgaacatgacggcacctttggatttcatccatgtgcacgtcgtcggtggaaac
gttcttccgacgcaggagcctgcaagaaatacggaagccgcgcgactaaacccgctcggc
gttattgtcgcgctggacgatggggggagtgcagtgggggatttgttctatgatgacgga
gacagtatcgatacgcacctgactggcgcctatttccacgctgtttataccatgtcctct
ggcaccctgacgagcaccgtggtgcatgatgggtacccagaaatgggaaccaagacgctg
aacacgattcgtctcatgggactaaccacgcctgcgaccagtgtcactgtgaacggggtg
agtcacactgactttgagaatttggagtctggggaagtccttgtcagaaatttgaacctg
gttgccaattcagctttcaccgtggtcttcgcttaa

DBGET integrated database retrieval system