KEGG   Folsomia candida: 110859194Help
Entry
110859194         CDS       T05043                                 

Definition
(RefSeq) probable 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
fcd  Folsomia candida
Pathway
fcd00250  Alanine, aspartate and glutamate metabolism
fcd00280  Valine, leucine and isoleucine degradation
fcd00410  beta-Alanine metabolism
fcd00640  Propanoate metabolism
fcd00650  Butanoate metabolism
fcd01100  Metabolic pathways
Module
fcd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110859194
   00650 Butanoate metabolism
    110859194
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110859194
   00280 Valine, leucine and isoleucine degradation
    110859194
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110859194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fcd01007]
    110859194
Enzymes [BR:fcd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     110859194
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     110859194
Amino acid related enzymes [BR:fcd01007]
 Aminotransferase (transaminase)
  Class III
   110859194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Death RF3_C
Motif
Other DBs
NCBI-GeneID: 110859194
NCBI-ProteinID: XP_021963765
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MLRSLQILGRASSHKGVVVRGMASLNIAGEPSGPSMKTSMPGPKSKQLMDELNKLTQAGS
VQLFADYDKSYGNYLVDVDGNVFLDVYTQISSIPLGYNHPELFALFSDPHHIRTLVNRPA
LGVYPGGDWVQELKDSVLSVAPKGLKHVTTMACGSCSNENAFKAIFFWYRKQQRGGKDFT
PDELTSCMNNLPPGSPPLSILAFHGAFHGRTLAALTCTHSKAIHKIDVPSFDWPVARFPV
YKYPLEDNVGENKAEDKKCLANVEELIDIWKKKGNPVAGIIVEPIQAEGGDNHGSPEFFQ
GLQKLAKTKGVALLIDEVQTGGGPTGKMWGHEHFNLPETPDIVTFSKKMQTGGFYHKPEF
RPDQSYRIFNTWMGEPSKIQILNKILEIIKRDNVLENVQSTGSLMLKQLKEFQNKYPNHL
NSARGLGTFCAINCANGQLRDKIINLLREQGVQAGGCGENALRFRPTLVFQPKHASIFFD
KFETVLKKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttacgttcactccagattctaggacgggcgtcttcccacaagggggtagttgttcgg
ggtatggcgtcgttaaatatcgcaggtgaaccttccgggccttccatgaagacgagcatg
cctggaccaaagtccaagcaactgatggatgaactcaacaaactcacgcaagcgggcagt
gttcaactttttgcagactatgacaaatcctatggcaactacttggttgatgttgatggg
aatgtgtttttggacgtgtacacccaaatctcgtccatccccttgggttacaaccatccg
gaattatttgccctcttctcagatcctcatcacattcgcactcttgtgaatcggcctgca
ctcggcgtttatcctggaggagactgggtccaagaactgaaggattccgttctctcggta
gcacccaaaggattaaaacacgtaaccacgatggcttgtggctcttgttccaacgagaac
gccttcaaagccattttcttctggtatcggaagcaacagcgcggagggaaggatttcact
ccggatgagctgacttcatgcatgaacaatttgccaccgggcagcccacctctttccatt
ctcgcctttcatggagcgttccatggcagaactcttgcggccttgacctgcactcattcc
aaagctatccacaagattgatgtcccctcgttcgattggcctgttgccagatttccagtg
tacaagtacccactggaggacaacgttggagagaataaggccgaggacaagaagtgctta
gccaacgttgaagagttgattgacatttggaagaagaagggcaatccggtggctggaatc
attgtggagcccattcaggccgaaggtggggacaatcatggatcccccgaatttttccaa
ggcctccaaaagttggccaagacgaagggtgtggctcttctcatagacgaggttcaaacg
ggaggaggacccacgggcaaaatgtggggccacgaacactttaatctccccgaaacgccg
gatattgtcacttttagcaaaaagatgcaaactggaggattttatcataaacctgaattt
agaccggaccaaagctatagaatttttaacacttggatgggagaaccctccaagattcag
atcctgaataaaattctggaaataattaaacgtgacaatgtgctggaaaatgtgcagagt
acgggatctctcatgctgaagcaactaaaggaattccaaaacaagtatccaaatcatctc
aactctgctcggggcttgggaacattttgcgccataaactgcgcaaatggacaactgcgt
gataagatcatcaacctcttgagagaacaaggtgtgcaagccggtggatgtggcgagaac
gcgctacgtttcagacccaccctcgttttccaacccaaacatgccagcattttctttgat
aaattcgaaactgtgttaaaaaaattgtaa

DBGET integrated database retrieval system