KEGG   Folsomia candida: 110860205Help
Entry
110860205         CDS       T05043                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
fcd  Folsomia candida
Pathway
fcd00480  Glutathione metabolism
fcd00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110860205
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110860205
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     110860205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110860205
NCBI-ProteinID: XP_021964953
LinkDB All DBs
Position
Unknown
AA seq 250 aa AA seqDB search
MNSKHLAKGSQCPPPPVDKLRIYNMRFCPYAQRSVLVAIAKNIPHEIINCNLVDKPEWLF
TKNPGGKVPVLEEPDGKILYESLIVSDYLDEVYPNRPLHAKCPYQKALDKLMIEEFNKVT
TLFYKALTNLKPEGSAALKDSLVEFQKGLSPFEKELEKRGTTFFGGNDAPGMLDYMIWPW
IERVPVMKLSTDPDIFDFETAKKDNPNLESWRNAMKEDDAVKQYYLSAENHLKFIKSFLV
GKADYDFLVQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaacacctcgctaaagggtcacaatgtcctccaccaccggttgacaaattg
cggatctataacatgagattttgcccttacgctcaaagatctgtgttagtcgcaattgca
aagaatattccacacgagattatcaactgcaatttagtggacaaaccggaatggttattc
acaaaaaatccaggaggaaaagttcccgtgttagaggaaccagacggaaagattttgtac
gaaagtctaatagtgtctgattatctagacgaagtatatccaaatcgtccgttgcatgca
aaatgcccatatcagaaggcactggacaaacttatgattgaagagtttaacaaggttaca
acgttattctacaaagctttgacaaatttgaaaccagaaggttcagccgctctgaaagac
agcctggtagaattccagaaaggactttcaccatttgagaaagagttggagaaaagaggc
acaactttctttggaggaaatgatgctcctggaatgctagattacatgatttggccatgg
attgaacgcgtcccagtcatgaagttatccacagacccggatattttcgatttcgaaact
gcgaagaaggataatcccaacttggaatcatggcgaaatgcaatgaaagaggatgatgcg
gttaagcaatactatttgtctgctgaaaaccaccttaaattcatcaagagttttctggtt
ggaaaagccgattacgattttctcgttcaatga

DBGET integrated database retrieval system