KEGG   Folsomia candida: 110860549Help
Entry
110860549         CDS       T05043                                 

Definition
(RefSeq) aspartate aminotransferase, cytoplasmic-like
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
fcd  Folsomia candida
Pathway
fcd00220  Arginine biosynthesis
fcd00250  Alanine, aspartate and glutamate metabolism
fcd00270  Cysteine and methionine metabolism
fcd00330  Arginine and proline metabolism
fcd00350  Tyrosine metabolism
fcd00360  Phenylalanine metabolism
fcd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fcd01100  Metabolic pathways
fcd01200  Carbon metabolism
fcd01210  2-Oxocarboxylic acid metabolism
fcd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110860549
   00270 Cysteine and methionine metabolism
    110860549
   00220 Arginine biosynthesis
    110860549
   00330 Arginine and proline metabolism
    110860549
   00350 Tyrosine metabolism
    110860549
   00360 Phenylalanine metabolism
    110860549
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110860549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fcd01007]
    110860549
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110860549
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110860549
Enzymes [BR:fcd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     110860549
Amino acid related enzymes [BR:fcd01007]
 Aminotransferase (transaminase)
  Class I
   110860549
Membrane trafficking [BR:fcd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110860549
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110860549
  Exosomal proteins of other body fluids (saliva and urine)
   110860549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110860549
NCBI-ProteinID: XP_021965301
LinkDB All DBs
Position
Unknown
AA seq 408 aa AA seqDB search
MSTSKFSTVEAGPPIEVFALTQAFTSDTFEKKVNLGVGAYRTEQSTPWVLPIVRKLEAVM
AADTTLNKEYLPVLGLPAFAQAATKMLLGPESKAILEGRAVGVQSLSGTGALRVVGEFFA
KTLGATMIYSSDPTWENHRLVFLNAGFTTYSSYAYWDPVKKALNIEGMLADLNAAPPNSI
IILHACAHNPTGVDPTQDEWKQIAKVMKEKKLFPLFDSAYQGFASGDLDADAWAVRYFEQ
EGFEFLCCQSFAKNFGLYNERIGNITIVTNDKDTLPKVLSQITLIIRGMYSNPPQHGGRI
VAMALNDPEYFAEWKGCIQTMAGRIKKMRAGLKERLEKLGTPGDWGHVTRQIGMFSYTGL
NVPQVEYLRTNYHIYMLKSGRINICGLTEANLDYVAASIDDAVRKVPA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctctaaattctccacggtcgaggccggccctcccatcgaagttttcgccttg
acccaggcctttaccagtgacacgttcgaaaagaaggtcaacttgggcgtgggagcgtac
cggacggaacaatcgaccccgtgggtgttaccgatcgttcggaaacttgaagccgtcatg
gcggcggataccacattaaataaggaatatcttccagtcctcggcttgcccgcgttcgcc
caagcagcgaccaaaatgctgctggggccggagtctaaagccatcctggaggggagagcc
gtcggagtccaaagtctcagcggtacgggggcgcttcgcgtcgtgggggaattcttcgca
aagacgctcggtgctaccatgatctattcgagtgacccgacctgggaaaaccatcgcctc
gtatttcttaacgctggtttcaccacatattcctcctacgcatattgggaccctgtaaaa
aaggcgctcaacattgaaggaatgttggccgatttaaacgccgctcctccaaattcgatc
atcattcttcacgcatgtgcccataatcctaccggggtcgaccctacgcaagacgagtgg
aaacaaatcgccaaggtcatgaaagagaagaagttgtttcccctcttcgactcggcttat
caaggcttcgcttccggagacttggacgctgacgcctgggccgtccgatactttgagcag
gaaggcttcgaattcctctgctgtcaaagtttcgccaagaattttggattgtacaacgaa
cgtattggaaacatcacaatcgtgaccaacgataaagacacgctgcccaaagtcctctca
caaataaccctcatcattcgtgggatgtactccaaccctccacaacatggcgggagaatc
gtcgcaatggcgttgaacgatccagaatatttcgccgaatggaaaggttgcattcaaacg
atggctgggaggattaaaaagatgcgcgccggactgaaggaaaggctcgaaaagttggga
acgcccggagattggggtcacgtgacgagacaaattggaatgtttagctacacgggatta
aatgtcccgcaagtcgagtatctcagaacaaactatcacatttacatgctcaaatcggga
cgaatcaatatctgcggactgaccgaggcgaatctagattatgttgcggcgtcaattgac
gacgcggtcagaaaggtgccggcatga

DBGET integrated database retrieval system