KEGG   Folsomia candida: 110860904Help
Entry
110860904         CDS       T05043                                 

Definition
(RefSeq) trypsin alpha-3-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
fcd  Folsomia candida
Pathway
fcd04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110860904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fcd01002]
    110860904
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110860904
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110860904
Peptidases [BR:fcd01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110860904
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110860904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 110860904
NCBI-ProteinID: XP_021965715
LinkDB All DBs
Position
Unknown
AA seq 249 aa AA seqDB search
MKVALVILGVVGVVLAGPALRQQPPERIVGGTEATRGEFPWIVTIQVGSHICGGSIVNAN
WIVTAAHCADYAANRYTIIGGEHNLNTNQGSEQSRTVAQIIKHPSYNPSTYANDIALMRL
SSPFTFGTYVRAANLPASGAGVSGNLVVCGWGTTSQGGSLSALLLKVTVPFVNTATCQQA
YGSQIVPGMICAGTGGRDSCQGDSGGPLHSGTTLVGIVSWGYGCAVAGYPGVYASVPYYR
NWISQHTGT
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagctctggtaattttgggagttgtgggcgtggttttggccggcccagccctg
cgacaacagccaccagaacgtatcgttggagggacggaagccacgcggggggaatttcca
tggatcgttacgatccaagttggttcccatatttgtggaggatcaatcgttaacgccaac
tggattgtgaccgcggcccattgcgcggattatgccgccaaccggtacaccattatcggc
ggggagcataacttgaacaccaaccaaggctcggaacagtccagaacggtcgcgcagatt
attaagcatccaagctataatccaagcacatacgctaacgacatcgccctcatgcgtctc
tcgtcccccttcacttttggcacgtacgtccgcgccgccaacttgcccgcttcgggtgcc
ggggtttctggaaatttggtcgtttgcgggtggggcacgacctcgcagggtggctccctt
tccgcccttcttctcaaggtcacggtccccttcgtcaacacggcgacgtgccaacaagcc
tacggatcacagattgttcccggtatgatttgcgccggaacgggagggcgcgactcgtgc
caaggagattctggtggcccccttcactcgggaaccacgttggtggggattgtttcttgg
ggatatggttgtgccgttgctggatatcctggagtctacgcatccgttccctactaccga
aactggatctcgcaacacaccggaacataa

DBGET integrated database retrieval system