KEGG   Folsomia candida: 110863190
Entry
110863190         CDS       T05043                                 

Definition
(RefSeq) uncharacterized protein LOC110863190 isoform X1
  KO
K20017  Bcl-2 family protein
Organism
fcd  Folsomia candida
Pathway
fcd04214  Apoptosis - fly
fcd04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110863190
   04215 Apoptosis - multiple species
    110863190
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110863190
NCBI-ProteinID: XP_021968133
LinkDB
Position
Unknown
AA seq 351 aa
MDLAGLMSSSSSSGQSKPKGADGLFGNVKGLTPSSTTRQRRPNADVVDEGFVEEDEEWCS
PVTKILKLPFDHESWQHAHELLEPPSPKSRKVADEARSIAARHIIDRLHEEDLLNKIQKV
APRLRSAVELLSKPDGDYVYPKFQFIVNDLRRRYPEVYTSVLDNVKLQIPVDMKPSTILV
SLAKSTVENTFGQLEMDWGKFAALLGLAGALAVDSVKAGYPEGVAEVVEAFGVIVEQVLG
EWILSDGGGWEGFIELNVYTAKLPPVLRTIIILCALSIVVYLLFYLIMSTALVLLHSLGV
LGEDEEMLFFQKWYGIYPKAYCTEKLDAMGGKSFSPVDPFQYLLALHDGKF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggatttggcagggttgatgtcatcgtcatcatcatcaggccagtcgaaacctaaggga
gctgatgggctgtttgggaacgtcaagggtctgaccccatcatccacgacaaggcaacga
cgacccaatgcagacgtcgtagatgaggggttcgtggaggaggacgaggagtggtgcagc
ccagtgacaaaaatcctcaagctcccctttgaccacgaaagttggcaacatgcccacgaa
ctcttggaaccaccctcgccaaagtccagaaaagttgcagatgaggcaagaagcattgcg
gctcgtcatataattgaccgtctgcatgaggaggatttgttgaacaagattcaaaaagtt
gcacctcgccttcgatctgctgtggaacttctttctaaaccggacggagattacgtttat
cctaaatttcagtttattgtcaacgacctgaggagaagatatcctgaggtttatacatcg
gttttagataatgtgaagctgcaaataccagtggatatgaagccatccaccatactagtc
tcactcgccaagtcaactgtagaaaatacatttggacaattggaaatggactggggaaaa
tttgctgcattgctgggactcgctggagcactagcagttgattctgtgaaagctggatac
ccggaaggagtcgcagaggtggtggaagcctttggtgtcatagtcgaacaagttttgggg
gaatggattctatcagacggtggaggatgggaaggtttcatcgaactcaacgtctacacg
gccaagctgcccccagttctccgcacaattatcatactctgtgccctcagtatagtcgtg
tacctactcttttacctcatcatgtccactgcacttgtattgttgcacagtctgggagta
ctgggggaagacgaggagatgctctttttccaaaagtggtacggaatttatcctaaagct
tattgtacggagaagcttgacgctatgggagggaagtctttctctccagtggaccctttt
cagtatctattagctctgcatgatggaaaattctaa

DBGET integrated database retrieval system