KEGG   Francisella cf. novicida Fx1: FNFX1_0126Help
Entry
FNFX1_0126        CDS       T01937                                 

Definition
(GenBank) ribonuclease II family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
fcf  Francisella cf. novicida Fx1
Brite
KEGG Orthology (KO) [BR:fcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fcf03016]
    FNFX1_0126
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     FNFX1_0126
Transfer RNA biogenesis [BR:fcf03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    FNFX1_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AEB27074
LinkDB All DBs
Position
124986..126842
Genome map
AA seq 618 aa AA seqDB search
MQKNSLVIFKSKPAKVINLLDKKIEIETLDGKNIKLPAKSVQLLVESEKDFELESLKELE
IAELEMTWELLQEQQQTSVEELCELLFESIGVNQAYTVWLLVSEGEYFSFNDDFSINIHS
QEQKNAIVRDKQEKLKKEQELNDFIERLNNKTFNEDDRKFLKEIEALATLKTNKCRFFKY
LNMEESENSAYKSLLDIGYWDEFFNPYLYRYGAELEHNSAEFNYNSKSDNQRVDLTHLKA
YAIDDEGSNDPDDAISWDSQKNKMWVHIADPSSSISFGDEVDLQARARGSNLYVPEQIVM
MLPPQATAKLGLGLQEVSPAVSVGFTIDEQGDIHDIEICFSNIKVTRYSYEFVEENMHTL
ELGDIVSYAKYFTDKRLSKGAVELDFPEIKISLDANKNVKLTDLPRLNSRTLVRDTMLMA
GVAVGQFCIKNNISVPFSTQPEHDLGQDGLENIDSIADMFATRKKLQRGRYSTQPSIHAG
MGLEAYVQVTSPLRRYLDLIVHYQLRNFFQHKEMISAQEIDNIIAQVDIPIKSNRQTERF
SNSHWKLVYLIQNPDLEFQATVIEKLEKGRLMVSIAALAMTKKLSVSGKYDLNDQINLQN
TSVNLVTQEAFFRVIEEN
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaattctctagtaatatttaaatctaaaccagcaaaggttattaatctctta
gataaaaaaattgagattgagactctcgatggtaaaaatattaagttacccgcaaagagt
gttcaattacttgtagagtcagaaaaggattttgaacttgaaagtttaaaagagctagaa
atagctgaacttgaaatgacttgggaattattacaagagcaacaacaaacatctgttgaa
gagctatgtgagttactttttgaatctataggggtaaatcaggcttatactgtgtggctt
ttagtttcagaaggagagtattttagctttaatgatgattttagtatcaatattcattca
caagagcaaaaaaatgcaatagttagagacaaacaagagaaacttaaaaaagagcaagaa
cttaatgatttcatagagcgtttaaacaataagacttttaatgaagatgataggaaattt
cttaaggaaatagaagctctagcaacacttaaaactaataagtgtcgtttttttaagtac
ttaaacatggaggagtctgagaatagtgcgtataaatcgcttttggatattggctattgg
gatgagttttttaacccttatttatataggtatggtgctgagttagaacataattctgca
gagtttaactacaattctaaatcagataaccagcgagtagatctgacacatttaaaggct
tatgctatagatgatgaaggtagtaatgatcctgatgatgcaattagttgggatagccaa
aaaaataaaatgtgggtacatatcgcagatccttcttctagtattagttttggtgatgag
gttgatcttcaagctagagcacgaggctcaaatttatatgtgccggaacagatagtcatg
atgttacctcctcaagcaacagcaaaattaggcttaggcttacaggaggtatctcctgca
gtatctgtaggatttacgattgatgagcaaggtgatatccacgatattgaaatatgcttt
agtaatataaaagttacacgatattcttatgaatttgttgaagaaaatatgcatacttta
gagcttggcgatatagtaagttatgcaaaatatttcactgataagcgtttatctaaaggt
gcagttgagcttgatttcccagagataaagatatcattagatgctaataaaaatgttaaa
ttaactgatttaccacgtttaaactcaaggacacttgtgcgagatacaatgctaatggct
ggtgttgcagtaggacagttttgtattaaaaataatattagtgtacccttttctacacag
cctgaacatgatcttgggcaagatggtttagagaatatcgattcaatagctgatatgttt
gcaacacgcaaaaaactccaaagaggcagatactctacacaacctagtattcatgcaggg
atgggattagaagcctatgtacaagtaactagtccattgagaaggtatcttgatttgatt
gtacactatcagttacgtaattttttccagcataaagagatgataagtgctcaagagatt
gataacataattgctcaagttgatattcctataaaatcaaatagacaaactgagcgtttc
tcaaattcacactggaagttggtttacctaatccaaaatcctgacctggaatttcaagcg
acagttattgagaaattagaaaaaggtagattaatggtttctattgcagctttagcgatg
actaaaaaactttctgtcagcggtaagtatgatttaaatgatcaaataaatttacaaaac
acctcagtaaaccttgttacacaagaggctttctttagagttattgaagaaaattaa

DBGET integrated database retrieval system