KEGG   Francisella cf. novicida Fx1: FNFX1_0398Help
Entry
FNFX1_0398        CDS       T01937                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fcf  Francisella cf. novicida Fx1
Brite
Enzymes [BR:fcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FNFX1_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEB27346
LinkDB All DBs
Position
373029..373586
Genome map
AA seq 185 aa AA seqDB search
MTAFYKLCGMSMLSLVLADCTFLSANKPYDRDHDGELIVHMKDVNTHKEVGTITISPYIH
DGNQEGMLITPHLYNLPANTTHGMHIHINPSCEDNGMAAGGHWDPDNTQKHLGPYNDNGH
KGDLPVLVVNADGTATEPVVAPKLNSLEELAGHSLMLHAGGDNYSDKPQPLGGGGARMWC
GVIAD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgactgctttttataaattatgtggaatgagtatgctttcacttgtattagcagactgc
acatttttgtcagcaaataagccttatgatcgcgaccatgatggcgagttaattgtacat
atgaaagatgtcaatactcataaagaggttggaacaatcacaatatcaccatatattcat
gatggtaaccaagaaggaatgttgattacgccacatttatataatttacctgctaatact
actcatggcatgcatatccatatcaatcctagttgtgaagataatggtatggcagcaggt
gggcattgggatccagataatacgcaaaagcaccttggcccatacaatgataatggacat
aagggcgatttgcctgtactagttgttaacgcagatggtacagcaactgagcctgttgta
gcgccaaagcttaattctttagaagagctagcgggtcatagtttgatgcttcatgcggga
ggcgataattactctgataagccacaacctctaggcggaggtggtgctagaatgtggtgt
ggagttatagcagactaa

DBGET integrated database retrieval system