KEGG   Francisella cf. novicida Fx1: FNFX1_1619Help
Entry
FNFX1_1619        CDS       T01937                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00564  Glycerophospholipid metabolism
fcf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FNFX1_1619
Enzymes [BR:fcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FNFX1_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA FAD_binding_3 Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: AEE88004
LinkDB All DBs
Position
complement(1685650..1687182)
Genome map
AA seq 510 aa AA seqDB search
MKKEYDIIIIGGGATGFGCAIEAVSRGYKTLLLEASDFGKGTSSKSTKLIHGGLRYLENF
DFALVKEGLEERFSFLHNAPHLTHKQSYLIPTRSYFETIKYTIGVKLYEFLSGKYKIGKS
YNLNKQQTLAVLPNIDDSKLKKSLVYYDGQFDDTRLLISLMKTFEAKGGVALNYHKVEKI
FSSTDSKLDTVKVIDTLSGEQKEFTAKHIINATGTFSDKTISLANQQDAHKYVSVAQGTH
IVFDREKFPTEHAILIPETEDGRVLFILPWHDHLIVGTTDIKKEAPSLEPRADKSEIDFI
LETFNQYAKDKATIADIKSVYCGQRPLVTPKKAKNSAKISRKHEIVESKDGLITVVGGKW
TIFRRMGQDTLDYIETKKIAQKISKTSDQLLIDAIEPKDTYPLKVYGKNAEDIKTIQNEL
DNFELLARGLPYYQAEVIYHVRHEKAKTIEDVLARRTRAAFLDIKASIDAAPKVAELMAK
ELGKDEVWQNQQIDSFIEFSKNFNVEELYK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaatacgacataataataattggtggcggcgcaactggctttggttgcgct
attgaagcagtttctcgaggttacaaaactctacttctagaagcgagtgattttggtaaa
ggaacctcttcgaagtcaacaaaattgattcatggtggtttaaggtatctagagaatttt
gactttgccttagttaaagaaggcttagaagagagattctcttttttacataatgctcca
catttgacacataaacaatcttatcttattccgacgcgtagctattttgagactatcaaa
tacactataggagttaagctatacgagtttttatcaggtaaatacaaaattggtaaaagc
tacaatcttaacaaacaacaaacattggcagtgttgccaaatatcgatgattcaaaactt
aaaaagagcttagtgtattacgatggtcaatttgatgatactaggttgcttatttctttg
atgaaaacttttgaagcaaaaggtggtgttgctcttaattatcataaagtagaaaagata
tttagttcaacagattcaaaattagatactgtaaaagttatagatactttatcgggtgaa
caaaaagaatttacagctaaacatataatcaatgctacaggtacatttagcgataaaact
ataagtttagcaaatcagcaagatgcgcataagtatgtctctgttgcacagggaacacat
attgtttttgatagagagaaatttccaacagagcacgcaatcttaatcccagaaacagaa
gatggcagggtattatttatcttgccttggcacgatcatctaatagttggtactactgat
atcaaaaaagaagcaccaagtcttgagccgagagctgataaatctgagattgattttatc
ttagagacttttaatcaatatgcaaaagacaaggcaactatcgcagatattaagtcagtt
tactgtggtcagcgtcctttggtaactccaaaaaaagctaaaaattccgcaaaaatatcg
cgcaagcatgaaattgtagagtcaaaagatggcttaataacagttgttggaggtaagtgg
actatttttagaagaatggggcaagatactctagattatatagaaactaaaaaaatagca
cagaaaatatctaaaacatcggatcagttacttatagacgctattgagccaaaagatacg
tatcctctaaaagtttatggtaaaaatgctgaagatatcaaaactattcaaaatgagctt
gataattttgagcttttggcgagaggtctaccatactatcaggcagaggttatatatcat
gttcgacatgaaaaagctaaaactatagaggatgttcttgcgcgtcgaactagagcggca
tttttggatatcaaagcaagtattgatgctgcaccaaaggtagctgagcttatggcaaag
gagcttggtaaagatgaggtttggcaaaaccagcaaattgatagtttcatagaattttct
aaaaactttaatgttgaagagttgtataagtag

DBGET integrated database retrieval system