KEGG   Falco cherrug (Saker falcon): 102045797Help
Entry
102045797         CDS       T02911                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00512  Mucin type O-glycan biosynthesis
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102045797 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fch01003]
    102045797 (WBSCR17)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102045797 (WBSCR17)
Glycosyltransferases [BR:fch01003]
 O-Glycan biosynthesis
  Mucin-type
   102045797 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102045797
NCBI-ProteinID: XP_005439876
LinkDB All DBs
Position
Un
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDIHPRAEVVNLTARGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKWHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CEKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggagagtcaaagtcctgctggtgttaaacttgatcgcggtggctggc
ttcgtcctcttcctggccaagtgcagacccatcacggccaagagcggcgactccttccat
gacatccatcccagggcagaagtggtcaacctgacagcccgcggcatcagctccatccag
gatgcggtgttgaagagactctccctcctggaggacatcgtctacaggcagctgaacggt
ctgtccaagtcacttggtctcattgaaggctatggtggacgtggtaaaggtgggcttcca
gccaccctgtcccctgaggaggaggaaaaagcaaagggaccacatgagaaatatggctac
aactcctacctcagtgagaaaatttcactggatcgctccataccagattatcgtccaacc
aagtgcaaagagctgaaatacggcaaggacctaccccagatctccatcatcttcatcttc
gtgaacgaagcactctctgttatcctgcggtcagtgcacagcgcggttaatcacacgcca
gctcacctcctgaaggagattatccttgtggatgacaacagcgatgaagaggaactgaag
gcaccactagaagaatacgtcaataaacggtacccaggcctcgtgaaggtggtgcgcaac
cagaagagggaaggccttatccgagctcgtattgaaggctggaaagctgccactggccag
atcactgggttctttgatgctcacgtggaattcactgctggctgggctgagccggtgctt
tcacgaattcaggaaaatcggagaagggtcattcttccctccatagacaacatcaagcag
gacaacttcgaggtgcagcggtacgagaactctgcccatgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggatgccggagacccctcactgcccatc
aggacaccggcgatgattggttgctcatttgtggtgcacagaaaattctttggagagatt
gggcttctcgatcctgggatggatgtgtacggaggggagaacatagaactcggcatcaag
gtgtggctgtgcggtggcagcatggaggtcctgccctgctccagggtggctcacattgag
cgcaagaagaagccctacaacaacaacatcggtttttacaccaagcgcaatgctctgcgc
gtggccgaggtgtggatggacgactacaaatggcacgtttacattgcgtggaacctgccg
ctggagaatccaggtattgacattggggatgtttctgagagaaaagcgttaaggaagagc
ttgaagtgtaaaaatttccagtggtacctggaccacgtttatccagagatgagaagatac
aacaacaccattgcttatggcgagcttcgaaacaacaaggcgaaagatgtctgccttgac
cagggcccacaggagaaccacacagcaatattgtacccgtgccatggctggggaccgcag
cttgcacgctacaccaaggagggattccttcatctcggggccctcgggaccacgactctt
ctgcctgatacccgctgcctggtagataatgtgaaaagccgcttccctcagctcctcgat
tgcgagaaggtcaagagcagcctccataagcgctggaatttcatacagaatggtgccatc
ctgaacaaaggaacgggacgatgcttggaagtggagaacaggggaatggccggcattgat
ctgattcttcgcagctgcacaggacaaagatggacaattaaaaatttcatcaagtaa

DBGET integrated database retrieval system