KEGG   Falco cherrug (Saker falcon): 102045802
Entry
102045802         CDS       T02911                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X2
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04310  Wnt signaling pathway
fch04330  Notch signaling pathway
fch04350  TGF-beta signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102045802 (EP300)
   04330 Notch signaling pathway
    102045802 (EP300)
   04350 TGF-beta signaling pathway
    102045802 (EP300)
   04068 FoxO signaling pathway
    102045802 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102045802 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102045802 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102045802 (EP300)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102045802 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102045802 (EP300)
   03036 Chromosome and associated proteins [BR:fch03036]
    102045802 (EP300)
   03029 Mitochondrial biogenesis [BR:fch03029]
    102045802 (EP300)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102045802 (EP300)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102045802 (EP300)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102045802 (EP300)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102045802 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102045802
NCBI-ProteinID: XP_014137136
LinkDB
Position
Unknown
AA seq 2384 aa
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGMLNS
MVKSPMAQAGLTSPNMSMGASGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGMMQGQVMNGSIGAGRGRPNVPYPNPGMGSAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKAGLQNSLPQFPMDKK
PVPGAGMANKGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSINTTSQIDPSSIERAYAALG
LTYQGNQMQTQPQAQVKNQQQGQSPQGLRPMNPMSANPMGVNGGVGVQAPNLLPDSMLHS
TMNSQNPMMSESASVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPNAPGMPQAPMNQGPNMGQPQPGMSANGPLPDPALIRANVPNQMMNRMQAQPGMNQFG
QMNMQLSPMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQTQFPA
SSPGMNTASMPMTQPGNQTPVSQAQMTSASCPVNSPAMAPGSQGSHIHCPPLPQPPIHRN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAATTAPTPAPQAMPPGPQSQTMHPPQRQTPTP
PQAQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLKAEPVVEEC
KPDPMEQEEKKSEVKTEVSEGEERPATPATQSSPAAGQSKKKIFKPEELRQALMPTLEAL
YRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMF
NNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTI
PRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFV
ECIECGRKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENR
VNDFLRRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDNGEMAESFPYRTKALFAFEE
IDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYV
KKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKD
IFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDS
KNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPA
ANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDR
FVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQ
SPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQL
IALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQ
GLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPASQPQPAPPNSMPPYTMPRTQPPSAVSQ
GKAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQ
MPPMGMNPPQIGRGPGGHIDQGMGPAGIQQQPPWVQGGLPQAQLQPGMQRPSMMSVAQPG
QPMNMAPQPGMGQVPGAAQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLL
AAFIKQRAAKYAGSQNPQGMTGQPGIPQGQPGLQPQQAMQGQQGGVHPSPAMQNMNPMQA
GVQRPSMPQQQPQQQPQQAMAGMNPQTQQMNMNHSGMAPQFRDLLMRRHQMIEQQRHQQQ
QQQQGAGPALGAGMANHNQFQQPQGVGYPQQQQQRMQHHMQQMQQGNMGQISQLPQAMSA
ETGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVRSP
QPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQS
AMLSQLASNPGMAGLHGTSATELGLSSENSDLNSNLSQSTLDIH
NT seq 7155 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactttttgatctggaa
catgacttgccagacgaactgataagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagactagccttggcctggcacaggatgctgcctctaaacataagcag
ctgtctgaacttctacgggctggtagttccccaaatctcaatatgggggttggtggccct
ggccaaggcatggccagtcaaacccaacaaaatagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaggctggtttgacttctcccaatatgtcaatgggtgca
agtggaccaaaccagggtccttcagcccaatccacagccggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacaggggatgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgacctaatgtgccatacccaaacccaggaatgggtagtgct
ggtaacttgttggctgagacactgcaacaaggctctccacagatgggaggacaggctgga
ctgagagggccacagcctggagcaatgaacaagatgggaatgatgagcaaccctagccct
tatggtcagccatatagtcagaatactgggcagcagattggagccagtggacttgggcct
cagatgcaaaataaagctggactgcagaatagcttaccacagtttccaatggacaagaag
ccagttcctggggcaggaatggctaacaagggccaacagcaggctccccaagttcagcaa
gctgggatggggccagcagcttctcaaggaatggggtctggagcaccaacagcggatcca
gaaaaacgcaaactcattcagcagcaactcgttctcctcttgcacgctcataagtgtcag
cggcgagaacaggccaacggggaggtgcgacagtgcaacctccctcattgccgaaccatg
aagaatgtcctgaaccatatgacacattgtcaggcgggcaaatcttgccaggtggcacat
tgcgcatcttcccgacaaatcatctcgcactggaagaattgtacgagacatgactgtcct
gtatgtttgcctctcaaaaatgctggggacaaaagaaatcaacaatcgctgctgggcgga
gctgcagtaggacttgcaaatactggctctgtgggtgtggggcagcagacaacgcccagc
ataaacactaccagtcagatagaccccagctccattgagagagcctacgcagccctcgga
ctgacctatcaagggaaccagatgcagacacagccccaggcgcaagtgaagaatcagcaa
caaggacagtcaccccagggtctgcgccctatgaatcctatgagtgcaaatccaatgggt
gtgaatggaggagtaggggttcaagcccctaatctgctgcctgactcaatgttgcattca
acaatgaattctcaaaaccccatgatgagtgaaagtgccagcgttgccagtttgggagcc
atgccaacggctcaaccatccaatactggaattcgaaagcagtggcatgaagacattact
caggatcttcgaaaccaccttgttcataaattagtccaagccatatttccgactcctgac
cctgcagcactgaaggatcggcgtatggagaatctggtggcatatgctcggaaagtggag
ggggatatgtatgaatcggcaaatagcagggcagagtactatcacttgctagcagagaag
atctataagattcagaaggagttggaggagaaacgaagaaccaggctgcagaagcaaaac
atgatcccaaatgctccgggcatgccacaggctcccatgaaccaagggcccaacatggga
cagccccagccagggatgtctgcaaatggtcctcttcctgatccagccctaatacgtgcc
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cagatgaacatgcagctgtcaccgatgggaccccggcaaacccctcctcttcagcaccct
ggacagctaagccaggctggggccatgaaccagatggggtttccttcacgtatgcagcag
ccaggagttggccagccttctggtcagaaccagtttctacaacagacccagttccctgct
tcttcaccgggaatgaacacagcaagcatgcctatgactcagcctggcaatcagacacca
gtttctcaagcacaaatgaccagtgcttcctgtcctgtgaattctcctgcaatggctcca
ggttctcaagggagccatattcactgcccacctcttccacagcctcccatacaccgaaat
tctccttccccagtacctagtcgaaccccaacacctcaccacacacccccaggcttggga
tcacagcaacagcaggcagcagcagctgccactactgcccccacacctgctcctcaggca
atgccacctggaccacagtcgcaaactatgcacccccctcaaaggcaaactccaacacct
ccgcaggcacagctgcctccacaggtccagcctccggttccagttaccccttctgcagag
caacagcagcaacctttgtcacagcagagcacgactgcatctgttcctacaccaacagca
ccgctgcagcctcagcaccccacaacacctcttaaagcagaaccagttgtggaggagtgt
aaaccagacccaatggagcaagaagagaagaaatctgaagtgaagactgaagtatcggag
ggggaagaaagacctgctactccagctactcagtcttctccggcagctgggcagtctaag
aaaaaaattttcaagccagaggagttacggcaggcgcttatgccaacactggaggcactt
taccgtcaggatccagagtctcttccatttcgacagcctgtagatccccagctactagga
attcctgattattttgacatagtgaagaaccccatggacctctctactatcaagaggaag
ctagacacaggacagtatcaggaaccgtggcaatatgtagatgacatctggctcatgttc
aataatgcctggttgtataaccgcaaaacatcccgggtatataagtactgttccaaactg
gcagaggtgtttgagcaagaaattgacccagttatgcagagccttggttattgctgtgga
agaaagttggagttctcaccacagactttgtgttgctatgggaaacagctatgcacaatt
cctcgagatgccacttactacagttaccagaacaggtatcatttctgtgagaagtgcttc
aacgaaatccaaggggagagtgtttctctgggagacgacccatcacaacctcagaccacg
ataaacaaagaacagttttcaaaaaggaaaaatgacacactggaccctgaactatttgtt
gaatgtatagagtgtggaagaaaaatgcaccagatctgtgttcttcacaatgaaataatc
tggccttctggctttgtctgtgatggctgcctaaagaaaacaggacgcaccaggaaagag
aataaattctctgctaaaaggttaccagctacaagacttggtaccttcttggagaataga
gtcaatgatttcctaagacgacagaatcaccctgaggcaggagaggttacagttagggtg
gtacacgcatctgacaaaactgttgaagtaaagccaggaatgaaagcaaggtttgtagac
aacggagagatggctgagtctttcccttatcgaacaaaagcgctttttgcctttgaggaa
attgatggtgtagacttgtgcttctttgggatgcatgtacaggagtatggctcagactgt
cctccacccaatcaaaggcgagtgtatatatcttaccttgacagtgttcatttctttcgc
cctaaatgcttgaggactgctgtctatcatgaaatactaattggatatctagaatatgtc
aagaaactagggtatactactggacatatctgggcatgcccaccgagtgaaggagatgac
tacatcttccactgccatcctcctgaccaaaagatacccaaacccaagcgactgcaagag
tggtacaaaaagatgctggacaagtctgtgtcggagcgcattgtccatgattacaaggat
atatttaagcaggcgacagaagatcgtctaacaagtgcaaaagagctaccttacttcgaa
ggggatttctggccgaacgttctagaggagagcattaaagaactagagcaagaggaagaa
gaacgaaagagagaagaaaacactagtaatgaaagcacggatgtgagcaagggagacagc
aaaaatgccaaaaagaagaacaataagaagacaagtaagaacaagagcagcttgagtcgt
ggcaataagaaaaagcctggcatgcccaatgtgtccaatgacctctcccaaaagctgtat
gccactatggagaagcacaaggaggtcttctttgtcatccgtctcattgctggccctgca
gccaactccctgccccccatcgttgagcctgacccgctcattccatgtgacctgatggat
ggacgtgatgctttcctaacacttgctagagacaagcacctggagttctcctcactacga
agggctcagtggtcaaccatgtgcatgttggtggaactgcatacccagagccaagaccgc
tttgtttacacctgcaatgagtgcaagcatcacgtggagaccagatggcactgcactgtt
tgtgaggattatgacctgtgcatcacctgctataacactaaaaaccatgaccacaagatg
gaaaaattaggccttggtctagacgatgagagcaacaaccagcagactgcaaccactcag
agccccggtgattcccgccgcctgagcattcagcgctgtatccagtctctggtccatgcc
tgccagtgtcgtaatgccaactgctcactgccatcctgtcagaagatgaaacgggttgtc
caacacaccaaaggctgcaaacgcaaaaccaacggagggtgccccatctgcaagcaactc
attgcgctctgctgctaccatgcaaagcactgccaggagaacaagtgccccgtgcccttc
tgcctcaacattaaacacaagctccgtcaacaacagcttcagcaccgcctgcaacaggcg
cagatgctccgaaggaggatggcaagtatgcagcggactggtgtggtgggccagcagcaa
ggattgccctcgcccacaccagccactccaacaactccaacaggccagcagcccccaaca
ccacaaaccccgcaaccccagcctccaccccagcctgcctcgcagcctcaacctgcacct
cccaacagtatgccaccctacaccatgccgagaactcagccccccagcgctgtgtcccaa
ggcaaggcaggtggccaggtgactcctccaacaccacctcagccacctcaaccaccggtt
cagggtcctcctccagcagcagtggaaatggccatgcagatccagcgggcagcagagacc
cagcgtcagatggcacaggttcagatcttccaaaggccgattcagcaccagatgccccag
atgccacctatgggaatgaaccctccacaaatcggcagaggtcctggtggtcatatagat
caaggaatggggccagcgggaatccagcagcagccaccgtgggtgcaggggggcttaccc
caagctcagctgcagccgggaatgcagaggccatccatgatgtcagtagcccagccaggt
cagccgatgaatatggcacctcagccagggatgggtcaggtacctggtgctgctcagccc
aagcaaccacctctgccccaggcagccttacaaaacctgctgcggactctcaggtctccc
agctcacccatgcagcagcaacaggtgcttaacatccttcactccaatcctcagctgctg
gccgctttcatcaagcagcgggctgccaagtacgcggggtcccagaacccccagggcatg
acgggtcagcctggcatccctcagggtcagccaggtctccaaccacagcaggccatgcaa
gggcagcagggaggggtgcatcccagcccagccatgcagaacatgaaccccatgcaagca
ggagtgcagaggcccagcatgccacagcagcagccgcagcagcagccgcagcaggccatg
gctgggatgaatcctcagacgcagcagatgaatatgaatcactcggggatggctccccag
ttccgagacctcctgatgaggcgacaccagatgattgaacagcagcgccaccagcagcag
cagcagcagcagggagcaggaccagcactgggggcggggatggccaaccacaaccagttt
cagcagccccagggcgtcgggtatccccagcagcagcagcagcgaatgcagcatcacatg
cagcagatgcagcaaggaaacatgggacaaataagccagcttccacaggcgatgagtgca
gagacaggagccagtttgcagcaggctttccagcagaggctacttcagcagcagatgggg
tccccagctcagcccaaccctatgagcccccagcagcacatgctccccaatcaggcccag
tccccgcacctacagggccagcagctcccttcatcgctcaccaatcaagtgcgatctccg
cagcctgtaccctcaccgcggccccagtcccagcccccccattccagcccgtcccctcgg
atgcaacctcagccttctccgcaccacgtctccccgcagaccagctccccacatccagga
ctggtagccgcccaggctaaccccatggatcaagggcactttgccagcccggaccagagt
gcaatgctttcccagcttgctagcaatcctggcatggcaggcctccatggtacaagcgcc
acggaactggggctcagctctgagaactcagacttgaattcaaacctttcacagagtaca
ctagacatacactag

KEGG   Falco cherrug (Saker falcon): 102056653
Entry
102056653         CDS       T02911                                 

Gene name
CREBBP
Definition
(RefSeq) LOW QUALITY PROTEIN: CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04310  Wnt signaling pathway
fch04330  Notch signaling pathway
fch04350  TGF-beta signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102056653 (CREBBP)
   04330 Notch signaling pathway
    102056653 (CREBBP)
   04350 TGF-beta signaling pathway
    102056653 (CREBBP)
   04068 FoxO signaling pathway
    102056653 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102056653 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056653 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102056653 (CREBBP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102056653 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102056653 (CREBBP)
   03036 Chromosome and associated proteins [BR:fch03036]
    102056653 (CREBBP)
   03029 Mitochondrial biogenesis [BR:fch03029]
    102056653 (CREBBP)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102056653 (CREBBP)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102056653 (CREBBP)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102056653 (CREBBP)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102056653 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102056653
NCBI-ProteinID: XP_014133499
LinkDB
Position
Unknown
AA seq 2341 aa
MGKSPLNSGDSSASGLAKQAASTSGPTTPASQTLNSQAQKQVGLVTSSPATSQTGPGICM
NTNFSQTHQSLLNSNSGHSLMNQPQQGQGQVMNGSLGAAGSRXMQYSAPAMQGNAGSVLA
ETLTQVSPQMTGHTGLNTAQTGAMTKMGMTGNTSPFGQPFSQTGGQQMGATGVNPQLPNK
PGMANSLSPFPADIKSTPVTSVPNMSQMQTQVQQVGIVPTQAMATGPTADPEKRKLIQQQ
LVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIIS
HWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGIQNSIGSVGTGQQNTPSLSNPNPID
PSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLPAGGIT
TDQQASLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWHEHVTQ
DLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKI
YKIQKELEEKRRSRLHKQGMLGNQPALQTPGPQPPGIPQVAAAMGQAQPVRPPNGPMSMP
TVPISRMQVSQGMNQFNPMSIGNVQMPQAPMGPRAASPMNHPVQMNNMGAVPAMAMSPSR
MPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASSGAMNVNSVGMGQSTAQAGVAQQGQV
PSAALPNSMNMLGPQSGQLPCPPVTQPPLHQTTPPVSTAAGMPPIQHQTPTGMTPPQPAA
PTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQAQVTPQPQTPVQPQSVPTPQP
SQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKSEVKTE
ETEPETSETQVEAKTEVEEDLQGSSQTKEETDGAELKQEPMEIEEKKPEIKVDAKEEEES
STNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDY
FDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAEVF
EQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQ
GENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSG
FVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASS
DKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPN
TRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFW
PNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANK
KKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRD
AFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLN
IKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTPQTPQP
PPQPQPSPVSMSPAGFPSVSRTQPPTTVSTGKPANPVSAPPPPAQPPPAAVEAARQIERE
AAQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVNQMQQVSMNVPRPNPVSGPVMSNMQPG
QWQSPPMPQQQPMQPGMARPVMPMATPQAVAGPRMPGVQQPPRSIPPNALQDLLRTLKSP
SSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQAGIQPQPGMQQPQTGMQQP
GMHAQAGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQAINIMNPGHNPSMANMSPQYRE
ILRRQLLQQQQQQQQQQGGAGMAGGMAGHNQFQQPQGPGGYPQAMQQQRMQQHISIQGGS
MGQMAQMGQLNQMGQPGMGADGTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHML
SGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTG
SPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEG
L
NT seq 7026 nt   +upstreamnt  +downstreamnt
atgggtaagagccctttaaactcgggagactcttctgcttcaggcctggcaaagcaagca
gccagcacctctggacctaccacacctgcatcacaaactctgaactctcaagcacaaaaa
caagtggggttggtgacaagcagccctgcaacatcacagactggacctgggatatgtatg
aatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcacagttta
atgaatcagcctcagcaaggacaagggcaggtaatgaatggatctcttggggcagctgga
agcaggnnaatgcaatattctgcccctgccatgcaggggaatgcaggcagtgtgctggca
gagactttaacccaagtatctccacagatgactggtcacaccggactgaacacagcacag
acaggagcaatgacaaaaatgggaatgacaggtaacactagtccctttgggcagcctttc
agtcaaactggagggcagcagatgggagctacaggagtgaatcctcagttaccaaacaag
ccaggcatggcgaatagtttgtctccctttcctgccgacattaagagtactccagtcacc
agtgtgccaaatatgtcccagatgcaaacccaagtgcaacaagtggggatcgtaccgacg
caggcaatggcaactggaccaacagcagacccggagaagcgcaaactgatccagcagcag
ttggttttgctgcttcatgctcacaaatgtcagaggcgtgagcaagcgaacggagaggtg
cgggcctgtgctctcccgcattgtcgaaccatgaaaaatgtcctcaaccacatgacacac
tgtcaagctgggaaggcctgtcaagttgctcattgtgcatcttcaagacaaatcatctcc
cactggaagaattgtactcggcacgactgtcctgtgtgccttcctttgaaaaacgccagt
gacaaaagaaatcaacaaccccttttagggtctccagctggtggaatccaaaattccatc
ggttctgttggcacaggccagcagaacactccatcgctaagtaatcctaatccaattgac
cccagctccatgcaacgagcctacgctgctcttggactgccatatggcaaccagcctcaa
acacagttgcagccccaggtacaaggccaacagccggcacagcctcaggctcaccagcaa
atgaggaccattaatgcattgggagccaaccagatgaaccttcccgcaggaggaataaca
acagaccagcaagctagtctaatttctgaaactgctcttccaacatcccttgggacaaat
aacccactaatgaatgatggcacaaattctggcaatgttggaaacctcagctcaatgcca
acggctgcacctccttctagtaccggggtaaggaaagcatggcatgaacatgtcactcag
gacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccactcctgatccg
gcagcactgaaggatcgccgcatggagaacttggtggcttatgccaggaaagtggaagga
gatatgtatgaatctgctaatagcagggatgaatattatcatttattagcagagaaaatc
tataagatacaaaaggagctggaagagaaacggaggtctcgtctacataaacaagggatg
ttggggaatcagccagccttacagacccctggacctcagccccctggtatcccacaggtg
gctgctgccatgggccaggcacagcccgtgaggccgcccaatgggcctatgtccatgcca
accgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagtttaaccccatgtcc
atagggaatgtacagatgccacaagcacccatgggaccccgtgcagcttctccaatgaac
catcctgtacagatgaacaacatgggcgctgttcctgcgatggcaatgtctccttcccga
atgcctcagccacagaacatgatgggagctcattccaacaacatgatgggtcaggctcct
acccagaaccaattcctgccccagaatcagtttccagcatccagtggggctatgaatgtg
aacagcgtgggcatgggtcagtcaacagcccaggctggggtggcacagcaggggcaggtt
cccagtgctgctcttcccaactccatgaacatgctaggaccgcagagtgggcagttacca
tgtccaccagtgacccagccacctctacatcagactacacctcctgtgtctactgctgct
gggatgccacctattcagcaccaaacgccaactggaatgactccccctcagccagcagca
cccactcagccatcgacaccagtctcatcttcaggacaaacaccaacaccaacaccgggt
tctgttccaaacgcgacacagacacaaagcacgcctacagggcagactgcggcacaggct
caagtcacaccgcaacctcagaccccagttcaaccccagtctgtgccaaccccgcagcca
tctcagcagcagccaacatctgtgcaggcacagccacctggcactccactatcccaggca
gcagctagtattgataacagggtccccacccctgcctcagttgctagtgctgatacgaat
tcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaaactgaa
gaaactgagccagagactagtgagacacaagtggaagctaagactgaggtggaggaggat
ttacaaggatcttcacaaacaaaagaagaaacggatggagcagaactgaaacaggagcca
atggaaatagaagaaaagaagcctgaaataaaagtagatgctaaagaggaagaggagagc
agcactaacggaaccacttcacaatccacatcgccatctcagccccgcaaaaaaattttc
aaacctgaggagctgcgccaggctctcatgcctacccttgaagctttgtaccggcaggac
ccagagtctctaccttttaggcagcctgtggatccccagcttttagggattccagactac
ttcgacattgtgaagaatcctatggatctttcaaccattaaacgtaaattggatactggg
cagtaccaagaaccctggcagtatgtggacgatgtctggctaatgtttaacaacgcctgg
ctttacaatcgcaagacttccagggtctataagttttgcactaaactcgcggaggtgttt
gaacaagaaatcgatcccgttatgcaatcacttggctactgttgtgggcgcaagtatgag
ttttctccacagaccttgtgctgctatggcaagcagctgtgtactattcctcgtgatgct
gcctactacagttaccagaacaggtatcacttctgtgagaagtgtttcactgaaatccag
ggggagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatctctaaggat
cagtttgaaaagaagaaaaatgatacactagatccagagccgtttgttgactgcaaagag
tgtggtcggaagatgcaccagatttgtgtattacattatgatattatttggccttccggg
tttgtctgtgataattgtctgaagaaaactggtagaacacgcaaagaaaacaaattcagt
gctaaaaggctacagactacacgtttaggaaaccatttggaagacagagtaaacaaattt
ttacgacgacagaatcatcctgaagctggagaggtctttgtcagagtagtagccagttca
gataagacagtagaagttaaaccaggaatgaaatccagatttgtggattctggtgagatg
tcagaatctttcccttaccgtaccaaagctctatttgcatttgaggagatagacggagta
gatgtgtgcttcttcggcatgcacgtacaggagtacggctcggattgcccccctccaaat
acaaggcgtgtgtacatatcgtatctagatagtattcatttcttccgcccccgttgtctc
cgaactgcagtttatcatgaaatcctcattggatatttggagtatgtgaagaaacttggg
tatgtgacaggacacatctgggcctgtcccccaagtgaaggagatgactatatttttcat
tgccatccgcctgatcagaaaatacccaaacccaaacgtttgcaagaatggtataagaag
atgctggacaaggcatttgctgagagaatcattcacgactacaaggacatcttcaaacaa
gcaactgaggacaggctgacgagtgccaaggagctgccttactttgaaggtgatttctgg
cccaatgtgctggaagaaagcattaaggagttggagcaggaggaggaggaaaggaaaaag
gaagaaagtactgcagctagtgaaacaacagagggaagccagggcgacagcaagaacgcc
aagaaaaagaacaacaaaaaaaccaacaagaataagagtagcatcagcagagctaacaag
aagaaacccagcatgccaaatgtgtccaatgatttgtctcagaagctgtatgccactatg
gagaagcataaagaggtcttttttgtgattcatttacatgctgggcctgtaattaacacc
ctgcctcccattgtggaccctgatccattacttagttgtgatttgatggatgggcgagat
gccttcctcaccttagccagagataagcactgggagttctcctcgctacgccggtccaag
tggtccacgctctgcatgctggtagaactgcacactcaagggcaggatcgctttgtctac
acgtgcaatgagtgcaaacatcatgtggaaacaaggtggcattgcactgtctgtgaggac
tacgacctctgcattaactgctacaacactaagagccatgaccacaagatggttaagtgg
ggcctgggtctggatgatgagagcaacagccaaggggagcaacagtcaaagagcccccag
gagtcgcgacgactgagcatccagcgctgcattcagtcccttgtccatgcctgtcagtgc
cgcaatgcaaactgctcattgccatcctgccagaagatgaaacgggttgtccagcacacc
aagggctgcaagcgcaagaccaacggcggctgtccggtgtgcaaacagctcatagctctt
tgctgctaccatgccaaacactgccaagagaacaaatgccctgtgccattctgtctcaat
atcaaacacaagcttcgacagcagcagatccagcatcgcctgcagcaggctcagctcatg
cgcagaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttgccttctcct
acctcagcaacgcctggtacccctacgcagcagccaagtacaccgcaaacaccgcagcct
cctccccagccccagccttcccctgtaagtatgtcaccggctggctttcccagcgtgtcg
agaactcagccccctactactgtttcaacaggaaaacctgcgaacccggtttccgcgcct
ccacctccggctcagcctccgccggccgcggtggaagcggctcggcagatcgagcgagaa
gctgcgcagcagcagcagcagctctacagggtcaacaacattaacaatggtttgcctcct
ggtcgcccaggactagtaaacccgacggtgggttcagtgaaccagatgcagcaagtcagc
atgaatgtaccccggcccaaccccgtcagcggtccagtgatgtccaacatgcagcctggg
cagtggcagtcgcctccgatgccacagcagcaaccgatgcagccgggaatggcgagaccg
gtgatgccgatggcgacaccacaagcggtggccgggccgaggatgccaggcgtgcagcag
ccgccgcggagcatccccccaaatgcacttcaggacttactgaggaccttgaaatcacca
agttctccgcagcagcagcagcaggttcttaatatccttaaatccaaccctcagcttatg
gcagcttttataaagcaaagaacagccaaatacgtggctaaccagcctgggatgcagccg
caagcgggcatacagccccagcctgggatgcagcagccgcagaccggcatgcaacagcca
ggcatgcacgctcaagcaggattgcagaacatgaacgcgatgcaagcaggagtgcagcga
ccgagcgttcctccccagcagcaagggataggagctatgaatccccagggacaagcgata
aacattatgaaccccggccacaaccccagcatggcaaacatgagtccgcagtaccgagaa
atcctgaggcggcaattactgcagcagcagcagcaacagcagcagcagcaaggaggggct
ggcatggcaggagggatggcaggacataaccagttccagcagcctcaaggaccaggaggt
taccctcaagccatgcagcagcagcggatgcagcagcatatatcgatacagggggggtcc
atgggacagatggctcagatgggacagctgaaccagatgggccagcccggcatgggggca
gacggcactcccaacatccagcaagcactgcagcagcgcatcctgcagcagcagcagatg
aagcagcagatagggtcccccggccagcccaaccccatgagcccacagcagcacatgctc
tcaggacaaccgcaggcgtctcatctccctggccagcagatcgccacctccctcagcaac
caggtgcggtccccagcacccgttcagtctccccgtccccagtcccagccaccacattcc
agcccgtcacccaggatacagccccaaccgtcacctcaccacgtctctccccagactggt
tccccccacccaggactcgcagttactatggctagctccatggatcagggacacttgggc
aacccagaacagagtgcaatgcttccacaactaaacaccccgaacaggagtgcgttgtct
aacgaattgtctctggtcggtgacaccaccggggacacattagaaaaatttgtggagggt
ttgtag

DBGET integrated database retrieval system