KEGG   Falco cherrug (Saker falcon): 102045929
Entry
102045929         CDS       T02911                                 

Definition
(RefSeq) casein kinase II subunit alpha-like
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch03008  Ribosome biogenesis in eukaryotes
fch04137  Mitophagy - animal
fch04310  Wnt signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102045929
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102045929
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102045929
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102045929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102045929
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fch03009]
    102045929
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102045929
Protein kinases [BR:fch01001]
 Serine/threonine kinases: Other
  CK2 family
   102045929
Ribosome biogenesis [BR:fch03009]
 Eukaryotic type
  90S particles
   Kinase
    102045929
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Kdo Choline_kinase ABC1
Other DBs
NCBI-GeneID: 102045929
NCBI-ProteinID: XP_014138824
LinkDB
Position
Unknown
AA seq 363 aa
MSGPVPSRARVYADVNTQRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIISLLDIVKDPVSRTPALVFEHVNNTD
FKQLYQTLSDFDIRFYMYEILKALDYCHSMGVMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSTEALDF
LDKLLRYDHQTRLTARDAMEHPYFYPIAKDPARIGTSAGLSASNTPVSSSSMLAGINSIA
ASQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtcggggccagtgccgagtcgggccagggtctatgcagacgtgaacactcagagaccc
cgcgagtactgggactacgagtcgcacgtcgtggaatggggcaaccaagatgactatcag
ctcgtgcggaaacttggccggggcaaatacagtgaagtctttgaagccatcaacatcacc
aacaatgagaaggtcgtcgtgaaaatcctcaagcctgtgaaaaagaagaagatcaagcgt
gagattaagatcctggagaatctccgaggaggccccaacatcatcagcctactagacata
gtgaaggaccctgtgtctcggacacctgccctggtctttgagcatgtcaacaacacagac
ttcaagcaactgtaccagacgctgtctgattttgacatacggttctacatgtatgaaatc
ctaaaggcactggattactgtcacagtatgggtgtcatgcatcgagacgtcaagccacac
aatgtcatgattgaccatgagcacagaaagctgcgcctgatcgactgggggctggcagag
ttctaccaccctggccaggagtacaacgtgcgggtggcctcgcggtacttcaagggaccg
gagcttttggtagattaccagatgtacgactacagcttagacatgtggagtttgggctgc
atgctggccagcatgatcttccggaaagagcccttcttccacggtcacgacaactacgat
caactcgtgcgcattgcaaaagtgctgggaacggaggacctgtacgactacatcgacaag
tacaacatcgagctggatccccgcttcaacgacatcctcggcagacactcacggaagcgg
tgggagcgctttgtgcacagtgagaaccagcacctcgtcagcaccgaggcgcttgacttc
ttggataagctgctgcgctacgaccaccagacacgactcactgcccgggacgccatggag
cacccgtacttctatcccatcgcaaaagacccagcaaggatcggcacctcggctggactc
tcggccagtaacacgcctgtcagctcctccagtatgttggcaggcattaactcgattgcc
gcgtcacaa

KEGG   Falco cherrug (Saker falcon): 102047766
Entry
102047766         CDS       T02911                                 

Gene name
CSNK2A2
Definition
(RefSeq) casein kinase II subunit alpha'
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch03008  Ribosome biogenesis in eukaryotes
fch04137  Mitophagy - animal
fch04310  Wnt signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102047766 (CSNK2A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102047766 (CSNK2A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102047766 (CSNK2A2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102047766 (CSNK2A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102047766 (CSNK2A2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fch03009]
    102047766 (CSNK2A2)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102047766 (CSNK2A2)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: Other
  CK2 family
   102047766 (CSNK2A2)
Ribosome biogenesis [BR:fch03009]
 Eukaryotic type
  90S particles
   Kinase
    102047766 (CSNK2A2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Choline_kinase Kdo PAS_3
Other DBs
NCBI-GeneID: 102047766
NCBI-ProteinID: XP_027671903
LinkDB
Position
Unknown
AA seq 213 aa
MYELLKALDYCHSMGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRY
FKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYG
YLKKYHIELDPHFNDILGQHSRKRWENFIHSENRHLVSPEVLDLLDKLLRYDHQQRLTAK
EAMEHPYFYPVVKEQSQPSSENAVLSSGLTTAR
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtatgagctgctgaaggccctggattactgtcacagcatggggatcatgcacagggat
gtcaaaccccacaacgtcatgatagaccaccaacagaaaaagctgcggctcatagactgg
ggtctagccgaattctaccatccagctcaggaatacaatgtccgtgtggcctctaggtac
ttcaaaggaccggagctccttgtggactaccaaatgtatgactacagcttagacatgtgg
agcttaggctgtatgctggcaagcatgatcttccgaaaggagcccttcttccacggccag
gacaattatgatcaactggttcgcatcgcaaaggtcctgggcacagatgagctgtatggg
tatctcaagaaataccacatagaactggacccacacttcaatgatatcctgggccagcat
tcccggaagcgctgggagaacttcatccacagtgagaacagacacctggtcagtcctgaa
gtcctagacctcctggacaagctcctgcgatatgaccatcaacaaaggttgactgcgaag
gaggcgatggagcacccctatttctatccagtggtgaaggagcagtcccagcccagctct
gaaaacgctgtgctctccagtggcctgacaacagcgcgatga

KEGG   Falco cherrug (Saker falcon): 102057085
Entry
102057085         CDS       T02911                                 

Gene name
CSNK2A1
Definition
(RefSeq) casein kinase II subunit alpha
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch03008  Ribosome biogenesis in eukaryotes
fch04137  Mitophagy - animal
fch04310  Wnt signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102057085 (CSNK2A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102057085 (CSNK2A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102057085 (CSNK2A1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057085 (CSNK2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102057085 (CSNK2A1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fch03009]
    102057085 (CSNK2A1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102057085 (CSNK2A1)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: Other
  CK2 family
   102057085 (CSNK2A1)
Ribosome biogenesis [BR:fch03009]
 Eukaryotic type
  90S particles
   Kinase
    102057085 (CSNK2A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Kdo Choline_kinase FTA2 ABC1 Kinase-like
Other DBs
NCBI-GeneID: 102057085
NCBI-ProteinID: XP_014140261
LinkDB
Position
Unknown
AA seq 391 aa
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYPIVKDQARMGSSNMPGGSTPVSSASMMSGISSVPT
PSPLGPLAGSPVISATTTLGMPVPAAAGAQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcgggacccgtgccgagcagggccagagtttacacggatgtgaacacacacagaccc
cgggagtactgggactatgagtcgcatgttgttgagtggggaaatcaagatgactaccag
ctagttcgaaaattaggccgaggcaaatacagtgaagtatttgaagccatcaacattaca
aataatgaaaaagtagttgttaaaattctcaagcctgttaaaaagaagaaaatcaagcgt
gaaatcaagatcttagagaacttgcgaggcggtcccaatataatcactcttgcagatata
gtaaaagatcctgtgtctcggacacctgctttggtttttgaacatgtaaacaacacagac
tttaagcaattataccagacattaacagattatgatattcgattctacatgtatgagatt
ttgaaggctctagattactgccatagcatgggaatcatgcacagagatgtcaaacctcac
aatgtcatgattgaccacgagcacagaaagcttagactaatagactggggtttggctgaa
ttctatcaccctggccaagaatacaatgtcagagtggcttccaggtatttcaaaggacct
gaactccttgtagattatcagatgtatgattacagtctggatatgtggagcttgggttgc
atgttggctagtatgatattccgaaaggagccatttttccatggccatgacaactatgat
cagttggtgaggatagccaaggtgctgggaacagaagacctgtatgactacattgacaaa
tacaacattgaactggatccacgtttcaatgacattttgggcagacactcccgtaagcga
tgggagcgctttgttcacagtgaaaaccaacatctggtgagtccagaagctctggatttc
ttagacaagctgctgcgatatgatcaccagtcacgactcacagcgagagaagccatggaa
cacccctacttctatcccattgtgaaagaccaggctcggatgggctcgtccaacatgcca
ggtggcagcactcctgtcagcagtgcgagtatgatgtcagggatttcttcagtgccaaca
ccttcaccccttggacctctagcaggctcacctgtcatttctgccaccaccactctgggg
atgcccgttccagctgctgcaggcgctcagcagtag

DBGET integrated database retrieval system