KEGG   Falco cherrug (Saker falcon): 102045939Help
Entry
102045939         CDS       T02911                                 

Gene name
CNDP1
Definition
(RefSeq) beta-Ala-His dipeptidase
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00330  Arginine and proline metabolism
fch00340  Histidine metabolism
fch00410  beta-Alanine metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102045939 (CNDP1)
   00340 Histidine metabolism
    102045939 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102045939 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fch01002]
    102045939 (CNDP1)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     102045939 (CNDP1)
Peptidases and inhibitors [BR:fch01002]
 Metallo peptidases
  Family M20
   102045939 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 102045939
NCBI-ProteinID: XP_005432089
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MSSSTSSALETEIFQYIDVHQSDFIKDLKEWVAVKSDSVQPVLRKEVIRMMALAADRLAA
LGATVNLVSLGSHQLPDGQDLPLPPVILGELGKDPQNPTVCFYGHTDVQPAKKEDGWKTD
PYTLTEIDGNLYGRGATDNKGPVLAWINAVETFRALKLAMPVNFKFVIEGMEEAGSLGLE
KLLEEENQRFFSDVDYIVISDNLWLSNKKPALTYGSRGNACFFVEVECGGKDLHSGTFGG
IIHEPLTDLIALLDSLVDPTGHIQIPGIYDSVAALTEEERKLYESIAFDLEEHKNNSGVK
KFLYGTKEEILLHLWRYPSLSIHGIEGAFHEPGIKTVIPAKVVGKFSIRQVPHMDLSVVK
KQVVEHLESVFSKRNSPNKLTVSMPLGAKPWFADVNDPLYKAATRAIKTVFGEDPDYIRD
GSTVPIARMFQSITQKSVIMFPIGAADDGEHSQNEKISRHNYIEGTKVFAAFFLEISKLH
RHLHETSNVETNNW
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctcaacctcctcagcactggagactgagatcttccagtacattgatgtacat
caaagtgatttcatcaaggatcttaaggaatgggtggctgtgaaaagcgactctgttcaa
ccagttctgaggaaagaagtaatacgaatgatggcgttggcagcagacagactcgctgcg
ctgggagccactgttaatttagtaagcctgggatcacatcagttgcctgatggccaggac
ctcccactgcctcctgtgattcttggggaactggggaaggatccacaaaaccccactgta
tgtttctatggtcacacggatgtgcagcctgccaaaaaggaagatggctggaaaactgac
ccttacacattgactgaaattgatggaaatctctatggacgtggagcaacagataataaa
ggacctgtcctagcctggataaatgcagtggaaacgtttagagccttgaaattagccatg
ccagtgaatttcaagtttgtaattgaaggcatggaagaagcagggtccttggggctagaa
aagttacttgaagaagaaaaccagcgctttttctctgatgttgattatattgtgatttct
gacaacctctggctcagcaacaagaagcctgcccttacgtatgggagtcggggaaatgcc
tgcttctttgtggaggttgaatgtggtgggaaggaccttcactctggaacttttggaggc
atcattcatgagccgctgacggacctgatagctctgctggacagccttgtggatcccaca
ggtcatattcagatccctggaatctacgacagtgttgctgccctgacagaggaggagagg
aagttatatgaatcgattgcatttgatctagaggaacataaaaataatagtggtgtgaaa
aaattcctctatggcaccaaggaagaaatacttctacacctgtggcgttacccttctctc
tctattcatgggattgaaggagcttttcatgaaccaggaattaaaacagtcattccagca
aaagtcgttggcaaattctcaatccgtcaggtccctcacatggacctttcggttgtgaaa
aaacaggtggtggagcacttggagagtgtcttttccaaaaggaacagtccaaacaaactg
acagtgtccatgcctttgggtgcaaagccctggttcgctgatgttaatgatccactatat
aaagcagcaacgagggcaattaaaacagtttttggagaagatccagattatattcgggat
ggctcaacagttcccattgccagaatgtttcagagtataacacagaaaagtgtgataatg
tttccgattggagcagctgatgatggggagcactctcagaacgagaaaataagcagacac
aactacattgaaggaaccaaagtgtttgcagcctttttcctggagatatcaaagctacat
cggcacttacatgaaacatccaacgtggagactaacaactggtag

DBGET integrated database retrieval system