KEGG   Falco cherrug (Saker falcon): 102046056
Entry
102046056         CDS       T02911                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102046056 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102046056 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fch04052]
    102046056 (KITLG)
Cytokines and growth factors [BR:fch04052]
 Growth factors
  Growth factors (RTK binding)
   102046056 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102046056
NCBI-ProteinID: XP_027671178
LinkDB
Position
Unknown
AA seq 342 aa
MVYKHQDTAQLAFHLHTWLLESSKYCFSILPPNGQLAEKSCSCKLSLGIPEVPHGKASKC
AKTWIITCFCLQLLLLNPLVKAQNSCGNPVTDDVNDIEKLVGNLPNDYMITLKYVPKMDS
LPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKN
KDFVKENGHLYEEGRFIPEDFFRHFNSTIEVYKEFADTLYKNDCILPSTVETPENDSRVA
VTKTFLFPPVAASSLRNDSIGSNTNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGA
VYWKKTHPKSRPESDETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtctataagcatcaggatacagcacaattggcttttcatttgcacacgtggcttctg
gagtccagcaagtactgttttagcattctgccaccaaacggacaattagctgaaaaatcc
tgttcctgtaagttgtcattaggcattccagaagtcccccatgggaaagcaagcaagtgt
gcaaagacttggattatcacctgcttttgtcttcaactactcctacttaatccgcttgtc
aaagcccagaattcctgcgggaatccagtgacagatgatgtgaatgacattgaaaaattg
gttggaaatctcccaaatgattatatgataactcttaaatatgtcccgaagatggatagt
ctgcctaatcactgctggttgcatttgatggtgcctgaattttcaagaagtctacataat
cttctccagaaattttcagatatttcagatatgtctgatgttttaagcaattattcaatc
atcaataatctcacaaggataattaatgatcttatggcatgcctagcttttgataaaaat
aaggattttgtaaaagaaaatggtcatctttatgaagaaggtcgcttcattcctgaggat
ttttttaggcacttcaatagtaccattgaggtctacaaggagtttgcagacacattgtat
aagaatgactgcattctgccttcaacagtagaaacaccagaaaatgattccagagtcgct
gtcacaaaaacatttttgtttcctcctgttgctgccagctcccttaggaatgacagcatt
ggcagtaacactaacagtaacaaagaggcacttggcttcattagcagctccagcctgcaa
gggatcagcatagcactgacatcattgctgtctcttcttattggctttattttgggagcc
gtatactggaagaaaacacatcccaaatccagaccagaaagtgatgaaactacgcagtgt
catgactgtcaagaggaaaatgagataagtatgttgcagcaaaaagaaaaggaacatcta
caagtgtag

DBGET integrated database retrieval system