KEGG   Falco cherrug (Saker falcon): 102046077
Entry
102046077         CDS       T02911                                 

Gene name
LMO7
Definition
(RefSeq) LOW QUALITY PROTEIN: LIM domain only protein 7
  KO
K06084  F-box protein 20
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102046077 (LMO7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fch04121]
    102046077 (LMO7)
Ubiquitin system [BR:fch04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     102046077 (LMO7)
SSDB
Motif
Pfam: DUF4757 PDZ PDZ_6 LIM PDZ_2
Other DBs
NCBI-GeneID: 102046077
NCBI-ProteinID: XP_027656850
LinkDB
Position
Unknown
AA seq 1635 aa
MHDSHKDDRSYRRIPVIEPKPTADFNRFLPSKNKQTAYVPAPLRKKRTERNEDNRRSWAS
PAYTESDATFSSGRERNPVASCQNSRAECGLTNPASLQMIYECDSGSDSEDERRLPDVVM
DDLAKRRFLVRKSPVSSAAPGHHFMLRNDSPKSCSQENYPDGPLAAMLEPLSNQRRQRQL
DTKEEIKPRVNIPSELSGYFDEDEEEEIGIPNIEKDDLYFRKLSSSAANTVVAFDKFLPK
FWTPEEELLWKKIRKSSFKPWYKEIQGFSRKKSDSKDEEFAYQQSSVIVANQPRPSFDWN
SSCRRDQNYKPTAEYVGSSLSQITEGKILEASDQPSQFSLLQALQKYSDYLSSETKTKID
PTSGPRLIKCRKNISFVPGCKQGDAENGYLYPDLENDDLFVRKTGAFHVNQVVLQDPRYL
KKFSEQEPPLEGEIILQPRDGQTVIPDLEKDDMIFRKILSQKKEVPLSGAPDKYHPALFP
DPWSLPEEIRSKFLCLLEKNTTPEERKSNGRVLSPSSRHKXXXXXWKVGSNIQPVNFIPG
PCSEEDWKKWEAIREASRVRHKKRQMVERLFQKLSDEQGSKSLNDVSAEELQSLRKIRYE
ELQRIKEQLQEQDLKWQEDLAKWKNRRKSFTSELQKKKEEREEIERRASEVSERSTKSLK
EVQQEREDRDQDSYGQRKYEHRWTYSLNDDVFSEEKAPSTRSAAKADLIEEDTSYSTKDS
KSAYATRLCKENLPESSAAPEAPALPKSLAEEQSSALLSSRYSVNAQTGSAQVSASFPRS
YQKSDTSRLTSVVTPRPFGVHSRGISSLPRSFTMDDTQKYNGEVEKAKRTQTLFTSSSFS
QPDSAHPLSTSAFKSRGEEEEKEGVQSTPSPSLALPAKSQDTDAGSSILKQEHRIPPDSL
SLVSSVENVTLPEPEVSKSLEQYSEMRISINQRPGHSRSFGFTTNWSSSGAFVQTVEEGS
PAALCQLHVDDEIIAVNGTKVSGMDYSQWEEAISRALETGNLLMDVRRYGKNDWGKDQPS
LPHVRHKILNLTSMATNIIGTSENKWIDATSGEHISNVSTITTKRDFSSSLQSSDRETKM
INGMQGDLGSNEQRASEPISLKNLKRRSQFFEQGGPEPAMPDLPVPSISAPTRRVWDQEE
ERKRQEKWQKEQDRLLQEKYQREQEKLREEWLRAKQEAEKESSKYFDEEQSVLTLNTTSV
PAWAPSASSWRASPEGNTSEEPEGVGASELAACLQGEEEGRRKLQEEWRIQDEAALHFEQ
ERELQELELERQRKEREQQYAEEQRRRAEMEEQRRRAEMEEEQRRRAEMEEEQRCQTERQ
REVLVEMPQYQRHYERYEVSKTIEDQAGHPLIDRHYERYEVSKTIEEQPGQSFADRNKSK
SSSELNEFNTIRNGTQSKYSERSWNTGESQKKPQKEQNLSAAELERQQILQEMRKKTSLH
TDSSWIRQRSSSIHKEPISLYSSSMRRGESLDNLDSSRTSSWRHHTWLNQSASSSSLSSS
QDFSRPVSTSNRAYMCTPSSSKAPPAGTSARAPSVSQAAPRAQSPLSASQPGSQTRSRSV
SGKKICSYCNNVLGKGAAMIIESLGLCYHLHCFKCVSCGCDLGGSRSGAEVRIRNNKLFC
NDCYIRFKTGQPTSM
NT seq 4908 nt   +upstreamnt  +downstreamnt
atgcatgactcccataaagatgacaggtcttaccgtaggattcctgtgattgaaccgaag
cctaccgctgacttcaatcgcttcttacccagcaaaaacaagcagacagcgtatgtgccg
gcacccctacggaagaagaggacagagagaaacgaggacaataggaggagctgggcaagt
cctgcctacacagagtcagatgccacattttcaagtggacgtgaaaggaatcctgtagct
tcctgccaaaatagcagagcagagtgtggtctcacaaatccagcttccctccagatgatc
tatgagtgtgacagtggctctgattcagaagatgaaagaaggctgcccgacgtggttatg
gatgacttagcaaaacgtagatttctagtcagaaagagccctgtaagctctgctgcacct
ggacatcatttcatgttgcgcaatgactctcctaaatcttgctcacaagaaaattatcca
gatggtccactagctgcaatgcttgaaccactgagtaaccagaggaggcagaggcagttg
gatactaaagaggaaatcaaaccaagagttaacattccttcagaattatctgggtatttt
gatgaggatgaggaagaagaaataggcatcccaaacattgaaaaagatgatctctatttt
cgcaagctaagttcttcagcggcaaatacagttgttgcttttgacaaatttcttcctaag
ttttggactccagaagaagaattgctatggaaaaaaatcaggaaatcctctttcaaaccc
tggtataaagagattcaagggttcagtagaaagaaatcagattccaaggatgaggaattt
gcttaccaacaaagctctgtcattgttgctaatcaaccaagaccaagttttgactggaac
agcagttgcagaagggatcagaactataagccaactgctgaatatgtgggaagctcattg
tcacagattacagaaggaaaaatcttggaggcttctgatcagcccagtcagttttcgtta
cttcaggccctgcaaaaatattctgactacttgtcttctgaaacgaagaccaaaattgat
cctacttctggccctaggctcataaaatgtagaaagaatatttcctttgtaccaggatgc
aagcaaggagatgcggaaaatggatatctgtacccagatttagaaaatgatgacttgttt
gttcggaaaactggggctttccatgtgaatcaagttgttctccaagaccctcggtattta
aaaaaattctccgagcaggagcctcccctagagggtgagataatcctgcaacccagagat
ggccaaactgtaattccagatttggaaaaggatgacatgattttccgtaaaatcctttcc
cagaaaaaagaggtgcctttatcaggtgctccagacaagtatcacccggcactttttcct
gatccatggagtcttccagaggagatccggtccaaatttctatgtttacttgaaaaaaac
acgacaccggaggaaaggaagagcaacggcagagtgctgtcaccatcctcccgccataag
naannnnnnnnnncttggaaggtgggaagcaacatccagccagtaaatttcatcccaggt
ccgtgcagtgaagaagactggaagaagtgggaagcaatcagggaggccagcagagttagg
cacaagaagcggcagatggtggagagactgtttcaaaagctttctgatgagcaagggagt
aaatctttgaacgatgtcagcgcagaggagctgcagtcattgcgcaaaatccgttatgaa
gagctacaaaggataaaagaacagttgcaagaacaagatctaaagtggcaagaagatcta
gcaaaatggaagaatcgtagaaagagcttcacttctgaattgcaaaagaaaaaggaagag
agggaagaaatagaaaggagagcctctgaggtgtctgaaaggagtaccaaatcactgaaa
gaagtgcagcaggagagggaggacagagaccaagactcctatgggcagcgaaaatatgaa
cacagatggacgtattcactgaacgatgacgtgtttagtgaagaaaaagcaccttccaca
cggtcagcagcaaaagctgaccttatagaagaagatacctcctacagcactaaggacagc
aaaagtgcgtatgccacacggctctgcaaggagaacctgccagagagctcggctgctcct
gaagctcctgctctgccaaagagcctggcagaggagcaaagctcggctcttttgtctagc
cgctactcagtgaatgctcaaactgggtcagctcaggtttcagcttctttcccgagaagt
taccagaaaagtgatacctctaggttaacatctgtggttacaccaagaccttttggtgtt
cactcaagaggaatctcgtcacttccacggtcgttcacgatggatgatacccagaaatac
aacggagaagtagaaaaagctaaaagaactcagactttgttcaccagcagttcgttttct
caaccagactctgcgcaccctctctccactagtgcgttcaaaagcagaggtgaggaggag
gaaaaagaaggtgttcagtcaacaccttctcctagtttggcattacctgcaaaatcccaa
gacacagatgctggaagcagtattcttaaacaagagcatcgcattccccctgattctctt
tcacttgtatcttctgtagaaaatgtgactctgccggagcctgaagtttcaaaatcgctg
gaacagtacagtgaaatgagaatcagtataaaccagagacctggccacagtcgcagcttt
ggatttacaacaaattggagttcttcaggggcctttgtacagacagttgaagaaggtagc
cctgcagcactttgtcagctgcatgtagatgatgagatcattgctgtcaatggcacaaag
gtttcaggtatggactatagtcagtgggaagaagccatcagcagagcactagaaactgga
aacctactcatggatgtcagacgatatggaaagaatgactggggcaaagaccagccttcc
ctgccacatgtaagacataaaatcctcaatctcaccagtatggctaccaacattataggt
acatctgaaaataaatggattgatgcaacttctggagaacacatttcaaatgtttccacc
ataacaacaaaaagagacttctccagcagccttcaaagttctgatagagaaacaaaaatg
ataaatggaatgcaaggagaccttggctctaatgaacaaagagcgtctgaacctatttct
ttgaaaaacttaaaaagacggtcacaattttttgagcaaggaggcccagagcctgcaatg
cctgatctcccagtcccatccattagtgctcctactcgtcgggtttgggatcaagaggaa
gaaagaaaacgacaggaaaaatggcaaaaggagcaggaccgtttattgcaggagaaatac
caacgtgaacaagaaaaactgagggaagaatggctgcgagctaagcaagaagcagaaaaa
gagagctccaagtattttgatgaggagcagagtgttctaaccttaaacacaacatctgtc
cctgcatgggctccatctgcatccagctggagagcaagccctgaaggaaatacttctgag
gagccagaaggagttggagcaagtgagctggcagcatgcttacagggtgaggaagaagga
aggaggaagctgcaggaggagtggaggatccaggacgaagcagccctgcattttgagcaa
gaaagggaactccaggagctggagcttgagagacaacgtaaagagagggagcagcagtat
gctgaggagcagaggcggcgggcagagatggaggagcagaggcggcgggcagagatggag
gaggagcagaggcggcgggcagagatggaggaggagcagaggtgtcagactgaaaggcag
agggaggtgttggtggagatgcctcagtaccaaagacattatgagcgctatgaagtatct
aaaacaatagaggatcaagctggccatcctctcattgacaggcattatgagcgttatgaa
gtttctaaaaccattgaggagcaacctggccagtcatttgctgacaggaataagtccaag
tcaagttcagaactgaatgaattcaacacaatcagaaatggtacccagagcaagtactca
gagaggtcctggaacacgggtgagtcacagaagaagcctcagaaggagcaaaacctgtct
gcagcagagttggaaagacagcaaatccttcaggaaatgagaaagaaaacatctctacac
acggacagcagctggattaggcagcgcagttccagtatacataaggagcctataagtctg
tacagcagtagtatgaggagaggggagtctttggacaatcttgattcttcaagaacaagc
tcatggaggcaccacacatggctgaaccagtctgcctcctcttcatctttgtcctctagt
caagatttcagtcgcccggtgtccacttcaaaccgagcctacatgtgcactccttcctcc
agcaaagcacctcctgcaggcacctctgcaagagccccctctgtgtcccaggcagccccc
cgagctcagtctcccctctctgcttcccagccagggtcccagacacgcagcaggtcagtc
agtgggaagaaaatctgttcatactgtaataacgttctgggcaaaggagcagccatgatc
attgagtctcttggtctttgttatcatttacattgctttaagtgtgtttcctgtggatgt
gacctcgggggatcccgctctggagctgaagttcggatccgaaacaacaaactcttctgc
aacgactgctatatcagatttaaaactggacaaccaacctccatgtga

DBGET integrated database retrieval system