KEGG   Falco cherrug (Saker falcon): 102046128
Entry
102046128         CDS       T02911                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04068  FoxO signaling pathway
fch04114  Oocyte meiosis
fch04140  Autophagy - animal
fch04144  Endocytosis
fch04150  mTOR signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102046128 (IGF1R)
   04068 FoxO signaling pathway
    102046128 (IGF1R)
   04150 mTOR signaling pathway
    102046128 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102046128 (IGF1R)
   04140 Autophagy - animal
    102046128 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102046128 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102046128 (IGF1R)
   04520 Adherens junction
    102046128 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102046128 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102046128 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fch04090]
    102046128 (IGF1R)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102046128 (IGF1R)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102046128 (IGF1R)
CD molecules [BR:fch04090]
 Proteins
  102046128 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD
Other DBs
NCBI-GeneID: 102046128
NCBI-ProteinID: XP_005436689
LinkDB
Position
Unknown
AA seq 1363 aa
MKSGAGGGSLAVFWGFLLVFAALCLWPTNGEICGPNVDIRNDIHELKRLENCTVIEGFLQ
ILLISKAEDYRNFRFPKLTVITDYLLLFRVAGLESLSDLFPNLTVIRGRNLFYNYALVIF
EMTNLKEIGLHNLRNITRGAIRIEKNSDLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTSINNEYNYRCWTTNHCQKMCPSSCGKRACTDQNECCHPECLGSCT
APDNNTACVACRNYYYEGVCMPTCPPNTYKFEGWRCVTKEFCSKVPATETSEYERFVIHN
DECMAECPSGFIRNGSQSMFCSPCEGPCPKICEDGKTKTIDSVTSAQMLQGCTILKGNLL
INIRRGNNIASELENFMGLIETVTGYVKIRHSHALVSLSFLKNLRYILGEEQVDGNYSFY
VLDNHNLQQLWDWNHHNLTIKEGKMYFAFNPKLCVSEIYRMEEVSGTKGRQSKGDINPRN
NGERASCESHILRFVSNTTLKNRIKLTWERYRPPDYRDLISFTVYYKEAPFKNVTEYDGQ
DACGSNSWNMVDVDLPPNKENNPGILLQGLKPWTQYAIYVKAVTLTMMENHHIHGAKSEI
VYIRTNAAVPSIPLDVISASNSSSQLIVKWNPPSLPNGNLSYYIVRWQQQPQDSYLYRHN
YCSKDKVPIRRYADGTIDTEEATEPTKPEGCGGEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPDRKRRDVFRIANATLAARNRNATGTDHFTNASDTEESEVEYPFFET
KVDGKERTVISHLQPFTLYRIDIHSCNHEADTLGCSASNFVFARTMPSEGADNIPGTVAW
EAKEENTVYLKWLEPVNPNGLILMYEIKYGQHGEEKRECVSRQEYKKLGGAKLTHLNPGN
YSARVQATSLAGNGSWTEPVSFYVQPKSANYGNFLHLIIVLPIAFLLIIGGLLIMLYVFN
KKRNSDRLGNGVLYASVNPEYFSASDVYVPDEWEVPREKITMCRELGQGSFGMVYEGIAK
GVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPDTENNPGQTPPTLKKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGMTNEQVLRFVMEGGLLEKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIIGSIKDELDPAFKEVSFFYSEENKPPDTEELDLETENMESIPLDPSSTLQPTDKHSG
HKAENGPGVVVLRASFEERQPYAHMNGGRKNERALPLPQSSAC
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgaagtctggcgctggaggagggtccctcgccgtcttctgggggttcctgctcgtcttc
gccgcactttgtctgtggccaacaaatggggaaatttgcgggccaaatgttgacattcgc
aatgatatccatgagctgaaacgcctggagaactgtacggtaattgagggtttccttcaa
attctgctcatctctaaagcagaggattaccgcaacttccgcttcccaaagctcactgtc
ataactgactatttgctgctgttccgtgtggcaggcttggaaagcctcagtgatctcttc
cccaacctcacagtcattcgtgggaggaacctcttctacaattatgccttggttatcttt
gaaatgacaaatcttaaagagattgggcttcacaacttgaggaacataacccgcggggcc
atacggattgagaagaactctgacctgtgttacctctccacagtggactggtctctcatc
ctagatgcagtgtccaataactacatcgttgggaataaacctcccaaggaatgtggggac
ttgtgcccaggcacgatggaagagaagccattgtgtgagaagacatctattaacaatgag
tacaactaccgctgctggaccacgaaccactgccagaaaatgtgccccagctcatgtggc
aagcgagcctgcacagaccaaaatgagtgttgccatcccgaatgcttggggagctgcacg
gcacccgacaacaacaccgcttgcgtggcctgccgcaattactactacgaaggagtctgc
atgcccacctgccctcccaacacctacaagttcgagggctggcgctgcgtgactaaagag
ttttgctccaaagtccctgccaccgaaacaagtgaatatgagagatttgtgattcacaac
gatgagtgcatggcagaatgcccctccggattcatacgcaatgggagccaaagcatgttc
tgcagcccttgtgaggggccttgccccaaaatatgtgaggatgggaaaacaaagacgatt
gactccgtcacgtcagcacaaatgttgcagggatgcacaattctgaagggaaatctgctg
attaacatccgtcgtggaaataacatcgcctcagaactggagaattttatgggtctgatt
gagacagtaacagggtatgtgaaaattcgtcattcccatgcattagtctccctgtctttc
ttgaagaacctgcggtatattctgggagaggaacaggtggacgggaattattctttctat
gtgcttgacaaccacaatcttcagcagctgtgggactggaaccatcataacttgacgatc
aaggaggggaaaatgtactttgcatttaatcctaaactgtgtgtttctgagatttaccgt
atggaggaagtttcaggaaccaagggacgacaaagcaaaggagatataaatccaaggaac
aatggagagagagcatcttgtgaaagccacattctgcgtttcgtttccaacactacgctc
aagaatcggattaaactaacatgggaacggtatcgccctccagattatagagatctcatt
agtttcactgtttactacaaagaagcaccattcaaaaatgtgacagagtacgatgggcaa
gatgcgtgtggctctaatagctggaacatggtcgatgttgacctgccaccaaacaaagag
aacaaccctggaattctactgcagggattgaaaccttggactcaatatgccatttatgtc
aaggctgttaccctcacaatgatggaaaaccaccatattcatggagcaaaaagtgaaatt
gtatatatccgaaccaatgctgcagtgccctccattcccttggatgttatttcagcatcc
aactcctcatcccaactgattgtgaaatggaatcctccctctcttcccaatggcaacctt
tcatactacattgtgcgatggcagcagcagcctcaggacagttacctttacagacacaat
tactgctccaaagataaagtcccaattcgaagatatgctgatgggaccattgatacagaa
gaagctactgaacccaccaagccagagggatgtggtggagaaaaaggaccttgttgtgct
tgtcccaagacagaggcagaaaagcaagctgagaaggaagaagcagagtaccgtaaagtc
tttgagaacttccttcacaactccatctttgtccccagacccgatcggaagcggagggac
gtgttccgaatcgcaaatgccactttggctgctcgaaacaggaatgcgactgggacagat
cacttcaccaacgcttctgacacagaggagagtgaggtggaatacccgttctttgagacc
aaagtggatggcaaggagagaactgtgatctcccatctccagccttttactctttaccgc
attgatattcacagctgcaaccatgaagctgacacgcttggttgtagtgcttccaacttt
gtctttgcaagaaccatgccttcagagggagcagataacattccaggaacagtagcatgg
gaagcaaaagaagaaaacactgtctacctgaagtggttagagcctgtgaatccaaatggg
ctgatactaatgtatgaaatcaaatatggtcagcatggagaggaaaagcgggaatgtgtt
tccaggcaggaatacaagaagcttggaggagctaaactcactcatctgaaccctggaaac
tattctgctagagttcaggccacttcgttggctggaaatgggtcatggactgagccagtc
tctttctatgtgcaacccaaatcagcaaactatgggaacttcctgcacttgataatagtg
ctccctattgctttcctgctcatcattgggggactgctgataatgctgtatgtctttaac
aaaaagaggaacagtgacagactgggcaatggagtactttatgcttctgtgaaccccgag
tacttcagcgcttcagatgtgtatgttccagatgaatgggaggtgccccgtgagaagatc
accatgtgtcgggagcttgggcagggctcctttggaatggtgtacgaggggatagccaag
ggagtggtgaaggacgagccggagacccgggtggccatcaagaccgtcaatgagtccgca
agcatgcgtgagaggatagagttcttaaacgaggcctcggtaatgaaggagttcaactgt
caccacgtggttcggctgcttggcgttgtttctcagggccagcctacgctggttattatg
gagctgatgacacgtggagacctcaaaagttacttgagatcattgaggccagacacagag
aataatcctggccagacacctccaactctgaagaagatgattcagatggcaggagagatt
gctgatgggatggcatacctcaacgccaacaaatttgttcacagagaccttgctgcgaga
aactgcatggtggcagaagacttcacagtgaaaattggagattttggcatgacaagagat
atctacgagacagattattatcgtaaaggagggaaaggtttgctgcctgtccgctggatg
tcccctgaatcactgaaagatggagtcttcacaacgcactccgatgtctggtctttcggt
gttgtactttgggagatcgcaacgttagcggagcagccgtaccaaggcatgaccaatgaa
caagtgctccgctttgtgatggaaggaggtctgctggaaaagccagacaattgccctgat
atgctgtttgaactgatgcgcatgtgctggcagtacaatccgaagatgaggccctccttc
ctggagatcatcggtagcattaaagacgagctggatccagcattcaaagaggtctccttc
ttctacagtgaagagaacaagcctccggatacagaggagcttgacctggagactgaaaac
atggagagcattcctttagatccctcctccaccctccaacccactgacaagcactcagga
cacaaagccgagaacggcccaggtgtggtggtccttcgggccagcttcgaggagagacag
ccgtacgcacacatgaacgggggacgcaagaatgagagggccttaccgttgccccagtct
tcggcctgctga

DBGET integrated database retrieval system