KEGG   Falco cherrug (Saker falcon): 102046148
Entry
102046148         CDS       T02911                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04020  Calcium signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102046148 (MET)
   04020 Calcium signaling pathway
    102046148 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102046148 (MET)
   04520 Adherens junction
    102046148 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102046148 (MET)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102046148 (MET)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  MET family
   102046148 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Syndecan Adeno_E3_CR2
Other DBs
NCBI-GeneID: 102046148
NCBI-ProteinID: XP_027664800
LinkDB
Position
Unknown
AA seq 1382 aa
MKSLTAYPSGFIVFLFALLQRSHGQCKEAAKKSEMNLNVKYDLPNFIAETPIQNVVLYKH
HVYIGAVNKIYVLNETLQNISVYKTGPILENPNCAPCEDCRDKANLSNSVWKDNVNLALL
LETYYDDQLISCGSVSGGICHRHIIHPDNPADIESEVHCMYSPRVDGEADNCPDCVVSTL
GTKVLVTEKDRFVNFFVGNTVTSTFQPPHVLHSISVRRLKETQDGFEFLTDQSYIDILPQ
FRDSYPVRYVHAFENDHFVYFLTVQRESLDSQAFHTRIIRFCTLDSEMRSYMEMPLECIF
TEKRRKRSIRKEVFNILQAAYVSKPGAALAHEMGLGLNDDILYGVFAQSKPDSSEPTNRS
AVCAVSVRTINEFFNKIVDKQNMKCLQHFYGKESKYCLNRAFSRNASYCRAQDDEYRLEV
TTPLQRVDLFMGQFNSVLLTSISVFTKGNLTVANLGTSDGHFMQIVVSRSEPTAPHVSFQ
LDSYPVSPQVVVEDSLADDGYTLVVTGKKITKIPLKGPGCHHFRSCSQCLLAPAFMQCGW
CSQQCLRSAECPGGTWTQETCLPRVYEILPSSAPLEGGTKLTLCGWDFGFSRNNRFELKN
TVVHIGGHICTLEAKSSNKNKLECTVPAAKNSSSNISSSVSVGHGKTLFSTFSYVNPVIT
SISPTYGPKSGGTLLTIAGKYLNSGKSRRIFVGEKPCTLKSVSASTVECYTPAQQIPQEY
RVRVGIDEAIRDAGGHFTYREDPVVLKIHPAKSFLGGGSTITAQGINLNSVCFPQMVITV
PKLGMNFSVACSHRSSSEIICCTTPSLKAFNLQPPFVTKVFFIFDGVSSLFFDFDYVNNP
VFKHFEKPVFISRGNQNVLEIKGNYIDSEAVKGEVLKVGNKSCENLLLQSESILCTVPSD
LLKSNSELNIEWKQEVLSTVIGKVLIRQDQNFTGLIAGVVSTSVLIFILLVFFLWRRKKK
QIKDLGSDLVRYDGRVHTPHLDRLVSARSVSPTTEMVSSESVDYRSTFLEDQFPSMSQNG
SCRPAQYPHSDLSPILSSGDSDLASPLLQTNVHIDISALNPDLVKEVQHVVIGADSLIVH
FSEVIGRGHFGCVYHGTLLDNDGRKIHCAVKSLNRITDLEEVAQFLKEGIIMKDFTHPNV
LSLLGICLPSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNSFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKPEMRPAFSELVSKISTIFSTFIGEHYVHVNATYVNVKCIAPYPSLLSSQDNTDMDA
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaagtctcttactgcatatccttctgggtttatcgtattcctgtttgccttgctgcag
aggagccatggacaatgcaaagaagcagctaaaaaatcagagatgaatttgaatgtaaaa
tacgatcttcctaacttcatcgcagaaacaccaattcagaatgtagttttatacaagcat
catgtttatattggagcagtcaacaagatttatgtactaaatgaaactctccagaacatt
tccgtgtacaagaccgggcccattttggagaaccctaactgcgcgccgtgcgaagactgc
agagataaagccaatttatctaacagcgtatggaaggataatgtcaacctggcactgctc
ttagaaacttactatgatgatcagctcatcagctgtggtagtgtgtccggaggcatctgc
caccgtcacatcattcaccctgacaaccctgctgacatcgaaagcgaggtacactgcatg
tattcaccccgggtggacggagaagcagataattgtcctgactgtgttgtaagcacttta
ggaaccaaagttttggtgactgaaaaggacaggtttgttaacttctttgttggaaatact
gtgacatctacatttcaacctccccatgtgctgcattcaatatcagttagaaggttaaaa
gaaacacaggatggttttgaatttctcacagatcagtcttacatagatatcctccctcag
ttccgtgactcgtatcccgttaggtatgtccatgcctttgaaaatgatcactttgtctat
tttctgactgtccagagagaatcacttgactcccaagcttttcacactagaattatccgc
ttctgcactttagactcagagatgcgttcttacatggaaatgcctcttgaatgtattttt
accgaaaagcggagaaagagatccatccgaaaggaggtattcaacattttgcaggctgcc
tacgtaagcaagccaggtgcagctctagcccacgaaatgggccttgggttgaacgatgat
atcctctatggtgtttttgcacaaagcaaaccagactcttctgaaccaaccaacagatct
gcagtctgtgccgtctccgtgcgaaccatcaatgagttcttcaacaagattgttgacaag
cagaacatgaaatgtctccagcacttttatgggaaagagagcaaatactgcttgaacagg
gctttttcaagaaatgcttcatactgcagagcacaagatgatgaatatcgcttagaagtt
acgactcctttgcagagggttgacttgttcatgggccagttcaacagtgtcctgctaact
tcgatatctgtcttcaccaaagggaaccttaccgttgctaatctgggaacttcggacggt
cacttcatgcagatagtggtttctcgttcagaacccacagctccacatgtcagctttcag
ctagactcctatcccgtctctccccaagttgttgtcgaggattcattagcagatgatggc
tataccctggtagtcactgggaaaaagataacgaagatcccgctgaaggggccaggctgc
catcacttcaggtcctgcagccagtgcctgctggcgcctgccttcatgcagtgcggctgg
tgcagccagcagtgcctccggtctgccgagtgccccggcggcacctggacccaggagacc
tgcttgcctagggtttatgagattctcccaagcagtgctcccttagaaggtgggacaaaa
ctgacactgtgtggatgggactttggattcagcagaaataatagatttgaattaaaaaat
acagtagtccatatcggagggcatatctgtactctggaagcaaaatccagcaacaaaaac
aagctggaatgcacagttcctgctgcaaaaaattcaagttccaatatatccagtagtgtt
tctgttggacatggcaaaacactattcagtacattttcatacgtgaatcctgtaataaca
agtatatctcccacctatggccccaaatctggaggaacattgctaactatagctggaaaa
tacctaaacagtggaaaatccagaaggatttttgttggtgagaaaccgtgcaccttgaaa
agcgtatcagcaagcactgtggagtgctacacaccggcacaacaaattccccaggaatat
cgtgtgagggtaggaatcgacgaagctattcgagatgcaggcggtcatttcacatacagg
gaagacccggttgttttaaaaattcatccagccaaatctttccttggtggtggaagtaca
atcacagctcagggaatcaacttgaactcagtgtgctttcctcagatggtgattactgta
cctaaactgggaatgaacttctctgtggcatgtagccaccgctctagttcagagataatc
tgctgtacaactccttcactgaaagccttcaacctccaaccaccctttgtaaccaaagtg
ttctttatttttgatggtgtcagctctttgttctttgattttgattatgtaaataatcct
gtatttaagcattttgaaaagccggtgttcatctcaagaggcaaccaaaacgttctggaa
atcaagggaaattacattgattcagaagctgttaaaggagaagtgctaaaagttggaaat
aaaagctgcgaaaacctcctcctgcagtcagaatcaattctgtgtacggttcccagcgat
ctcctgaaatccaatagtgagctgaacatagagtggaagcaagaagttttgtcaacagtt
attggaaaagtgctgatccggcaagatcagaatttcacgggactaattgctggagttgtt
tcaacatcagttttaatttttatcttattggtgtttttcctctggagaaggaagaagaaa
caaattaaagatctgggaagcgacctagtgcgctatgatggcagggtgcacactcctcac
ctggacaggctggtgagcgcgaggagtgtaagtccaacgacagaaatggtttcaagcgaa
tctgtagattacagatcaacttttctagaagatcagtttccaagcatgtctcagaatgga
tcgtgcagacctgcccagtatcctcactctgacctctccccgattctgtctagcggagac
tcagatttagccagtccacttctccaaactaatgtccacattgacatcagtgccttaaat
cctgacctggtcaaagaagtgcagcatgtggttattggtgctgacagcctgattgtgcac
ttcagcgaagtaataggaagaggacattttgggtgtgtgtaccatgggacattgctggat
aatgatggcaggaaaattcattgtgctgtgaagtcactgaataggattacagacctggaa
gaagtagctcagtttctgaaagaaggaataataatgaaagatttcactcatcccaacgtt
ctctcactcctgggaatctgtttgcccagtgaaggatcccccttagtcgttcttccatac
atgaaacatggagatcttcgaaacttcattaggaatgagactcataacccaacagtaaaa
gatttaattggatttggccttcaggttgcaaaagggatgaaataccttgcaagcaaaaag
tttgtccatagagacttggcagcaagaaactgtatgttggatgaaaaattcactgtcaag
gttgctgattttggtcttgctagagatgtctacgataaggaatactacagtgtgcacaat
aaaacaggagctaaactgccagtgaaatggatggctttagaaagcttacaaactcagaag
ttcacaacaaagtcagatgtgtggtcttttggtgtcttgttatgggaacttatgacaaga
ggggcaccaccttatcctgatgtaaattcttttgatataactgtttacttattacaagga
agaaggctgctacaacctgaatactgccccgacccactgtatgaagtcatgctgaagtgc
tggcatccaaaacctgagatgcgtccagcattttctgaactcgtttcaaaaatatcaaca
atcttctccacttttattggggaacactatgttcatgtgaatgctacttatgtcaacgtg
aagtgcattgctccctatccttctcttttatcatcacaagacaacacagacatggatgct
gacacatga

DBGET integrated database retrieval system