KEGG   Falco cherrug (Saker falcon): 102046260Help
Entry
102046260         CDS       T02911                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00052  Galactose metabolism
fch00500  Starch and sucrose metabolism
fch01100  Metabolic pathways
fch04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102046260
   00500 Starch and sucrose metabolism
    102046260
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102046260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102046260
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102046260
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102046260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102046260
NCBI-ProteinID: XP_005438285
LinkDB All DBs
Position
Un
AA seq 928 aa AA seqDB search
MKSYQKLTTTVPQPAACRVEEEGAASTPTGRGKLAPWWVGSGLLVAAVLLSTITVWVLRQ
VSGGWPRPTLPPKCLLVPENNRFDCYPERHVVVTQELCESRGCCFMETPPPAGGKRGVPW
CFYPPDFPSYTLESLNQTALGMVGLLVRREKAYYPQDIRMLRLDVEFQTDTRLHIKITDA
TNPRYEVPLEVPQTMKRAENPIYSLDFSWDPFGVLLRRKATGTVLLNTTVAPLIFANQFL
QISTSLPSKFLYGLGEHRGTFLHSLDWNTLTLWARDVAPTESFNLYGAHPFYLLMEEGGD
AHGVFLLNSNAIEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPL
WALSFHLCRWGYGSSNETWEIVRAMRNYRIPQDVQWNDIDYMDGYRDFTFDPQKFASLPS
LVEDLHKHGQRYVMILDPGISSTNPHGSYWPFDEGLRRGLFLNTTQGQPLIGQVWPGFTA
FADFSNPDTHQWWLENLQHFHAHVPFDGLWIDMNEPSNFMDGSEDGCPPGELDSPPYTPA
VLGDSLSAKTVCASAKQKASVHYNLHNLYGLMEAKATASALIQIRGKRPFVISRSTFPSQ
GQYSGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGA
FYPFARNHNTQNEQAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARP
LFFEFPQDVATLGLDRQFLWGQSLLVTPVLEPGVDSVTGYFPRGVWYDFYTGSSVNSSGE
TLKMSAPLEHLNLHVREGAILPTQKPGTTSEVTRGNPMRLIVALSSSATAWGDLFWDDGE
SLDTFEQGSYSYLVFNVTQNIFTSTVLHASTEATEVTIGTLSIFGVRQPPSKVLLNGQER
PFSYLDNEVLTVTDLGLSLSRGFSLRWL
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgacgacaacagtgccgcagccagcagcatgtcgggtggag
gaggaaggggctgcctcaacacccaccggccgtgggaagctggccccgtggtgggtgggc
agcgggctgctggtggctgctgtgctgctgagcaccatcacggtctgggtgctacggcaa
gtatcagggggctggcccagacccacactgccccccaaatgtctcctggtgcctgaaaac
aaccgctttgactgctacccggagcggcatgtcgtggtgacccaggagctctgcgaaagc
cgggggtgctgcttcatggagaccccgccgccggcagggggcaagcggggagtgccctgg
tgcttctacccccctgacttccccagctacaccctggagagcctcaaccagacagcgctg
ggcatggtggggttgctggtgcggagggagaaggcttattacccccaggacatcaggatg
ctgaggctggacgtggagtttcagacagacacgcggctgcacatcaagataactgatgcg
accaatccacggtatgaggttcccctagaggttccccagacgatgaagagggcagaaaac
cccatctacagtctggatttctcctgggacccctttggggtgctgctgcggcgcaaggcg
acagggacagtgctgctcaacaccaccgtggcccccttgatctttgctaaccagtttctc
cagatatccacatcgctcccgtccaagttcctctatgggctgggggagcaccgtggcacc
ttcctgcacagcctggactggaacaccctcacactgtgggcccgtgacgtcgctcccacg
gaatcgttcaacctgtacggtgctcatcccttctacctgctgatggaggagggcggagat
gctcacggggttttcctcctcaacagcaatgcaatagaggtggccctgcagcctgctccg
ggcctgacctggaggaccattgggggggtcctggatttttacatcttcctggggcctgat
cccaacatggtcatccagcagtaccagcaggtgataggtttcccagccatgccacccctc
tgggcactcagcttccacctctgccgctggggctatggatccagcaatgagacctgggag
attgtaagagccatgaggaactaccggatcccccaggatgtgcagtggaatgacatcgat
tacatggatgggtaccgggactttaccttcgatccccagaaatttgcctccctcccctcg
ctggtagaagacctccacaaacatgggcagcgctacgttatgatcttggatcccggcatc
agcagcaccaaccctcacggctcctactggccttttgacgaaggcttgagacggggcttg
ttcctcaacaccacccaagggcagccactcatcgggcaggtctggcccggcttcactgcc
tttgcagacttctccaacccagacacgcaccagtggtggctggagaacctgcagcacttc
catgcccacgtgccctttgatgggctctggatcgacatgaatgagccgtccaacttcatg
gatgggtctgaagacggctgccccccaggagagctggacagcccaccctacacaccggcc
gtgctgggtgattccctctctgcaaagacggtgtgtgcctcagcgaagcagaaagcctca
gtgcactacaacctccacaacctctacgggctgatggaagccaaagccacagcaagtgct
ctgatccagatccgggggaagcgcccctttgtcatctcccgctccaccttccccagccag
ggccagtactcggggcactggctgggtgacaaccggagccagtggaaggacatgtattac
tccatcccagggatgctgagcttcagcctcttcggcatcccgctggttggggcggacatc
tgcggcttctccggcagcacctcggaggagctgtgcacccgctggatgcagctcggtgcc
ttctaccccttcgctcgcaaccacaacacccagaacgagcaggcccaggacccaacagca
ttcagccccgcagcaaggacggccatgaaggatgtgctgctgacccgctactccctcctg
cccttcctctacactcttttccaccgtgcccacctgcaaggggacactgtcgcccggccc
ttgttctttgagttcccccaggatgtggccaccttgggactggacaggcagttcctgtgg
ggccagagcctgctggtgacgccagtgctggagcccggggtggactcggtcacaggctac
ttcccccgaggcgtatggtacgacttctacacgggctcctcggtgaacagcagcggggag
acactgaagatgtcagcccccctggaacacctcaacctgcatgtccgggagggtgccatc
ctgcccacccagaaaccagggaccaccagtgaggtgacccgagggaaccccatgcgcctc
atcgtggctttgtcctcgagtgccaccgcctggggggacctcttctgggatgatggcgag
agcctggacaccttcgagcagggcagctactcctacctggtgtttaatgtcacgcagaac
atcttcacctccaccgtcctccatgccagcactgaggctactgaggtcaccattggcaca
ctgagcatctttggggtgcggcagccacccagcaaggtcctcctgaatggccaggagagg
cccttctcctacctggacaacgaggttctcaccgtgaccgacctcggcctcagcctcagc
cggggcttctccctgcggtggctgtga

DBGET integrated database retrieval system