KEGG   Falco cherrug (Saker falcon): 102046316Help
Entry
102046316         CDS       T02911                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04110  Cell cycle
fch04114  Oocyte meiosis
fch04120  Ubiquitin mediated proteolysis
fch04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102046316 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102046316 (CDC23)
   04114 Oocyte meiosis
    102046316 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102046316 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fch04121]
    102046316 (CDC23)
   03036 Chromosome and associated proteins [BR:fch03036]
    102046316 (CDC23)
Ubiquitin system [BR:fch04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102046316 (CDC23)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102046316 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_16 ANAPC3 TPR_7 TPR_17 TPR_12 DUF772 TPR_9 TPR_15
Motif
Other DBs
NCBI-GeneID: 102046316
NCBI-ProteinID: XP_014136509
LinkDB All DBs
Position
Un
AA seq 563 aa AA seqDB search
MNQGPGAGQRAGCGRVSPRRASELAFALDPLPLSELPPPPALTEEDARDLDAYTLAKSYF
DLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALREL
RVELSKKHKARELDGFGLYLYGVVLRKLDLVKEAIDVFVEAAHVLPLHWGAWLELCNLIT
DKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYH
NIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKPELSYLAHNLCEIDKYRVETC
CVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEV
NKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKK
CYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIYSCGEIVEHLEVSTAFR
YLAQYYFKCKLWDEASACAQKCCTFNDTREEGKALLRQILQLRNQGETSSTDIAAPFFLP
ASLSANNTPTRRVSPLNLSSVTP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagggcccggggcggggcagcgggccgggtgcggacgggtctctccccgcagg
gcctccgagctggccttcgccttggacccgctgccgctgagcgagctgccgccgcccccc
gcgctcacggaggaggatgctcgtgatctggatgcctatacattagccaagtcttacttt
gatctaaaggagtatgacagggctgcctattttctgcggggctgcaagagtcagaaagct
tacttcttgtatatgtactctagatacctgtcaggggaaaagaagaaggatgatgagaca
gtggatagtttgggacctctggaaaaaggacaggtgaaaaatgaagctttacgtgaattg
agagttgagcttagcaagaaacacaaggcacgggaactggatggatttggcctttatcta
tatggggttgtgctgcggaagctggacctggtgaaagaagcaatagatgtgttcgtggaa
gctgctcatgtcttacctttgcactggggagcctggctggaactttgcaacttgattaca
gataaagagatgttgaagttcctgtccttgccggatacatggatgaaagagttctttctt
gcacacatttatacagagctgcagctgatagaggaggctctgcagaagtatcagagtctc
attgacgcaggattttccaaaagcacttacatcatctctcagattgcagttgcctaccac
aatatcagagatattgacaaagctttatccatctttaatgagctaaggaaacaagatcct
tacaggatagaaaacatggacactttctccaacttgctgtatgtaaggagcatgaagcct
gagttgagctacctggctcacaatctctgtgaaatagacaagtatcgtgttgagacctgc
tgtgtaattgggaattattatagcttgcgttcccagcatgaaaaagcagcactctatttc
cagagggccttgaaactgaatcctcgttatttgggagcctggacactcatgggacatgag
tatatggaaatgaagaacacatctgcagctatccaggcttacagacatgcaatagaggtg
aacaaaagggactacagagcgtggtatggcttggggcaaacctatgaaatcctcaaaatg
ccattttactgtctctattactatcgacgggcccaccagctcagaccaaatgattctcgt
atgctggttgctctaggagaatgctatgagaaactcaatcagttggtggaagctaaaaag
tgctattggagagcttatgcagtgggagatgtggagaaaatggcactggtgaaactagca
aagctgcacgaacagctgaatgaatctgaacaggcagctcagtgctatatcaaatacatc
caggatatctattcctgtggggagatagtggagcacctagaagtcagcactgccttccgt
tacttggcccagtactacttcaagtgcaagctctgggatgaagcctcagcatgtgctcag
aagtgctgtacgttcaatgatactagggaagaaggaaaggccctgctgcggcagatctta
cagcttcgcaatcaaggagaaacatcatccacagatattgctgctccctttttcctccct
gcatcattgtcagccaacaacactcctacacgtcgtgtctccccactcaatctgtcctct
gtaacaccatga

DBGET integrated database retrieval system