KEGG   Falco cherrug (Saker falcon): 102046830Help
Entry
102046830         CDS       T02911                                 

Gene name
SI, MGAM
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00052  Galactose metabolism
fch00500  Starch and sucrose metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102046830 (SI)
   00500 Starch and sucrose metabolism
    102046830 (SI)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102046830 (SI)
    3.2.1.20  alpha-glucosidase
     102046830 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102046830
NCBI-ProteinID: XP_005440217
LinkDB All DBs
Position
Un
AA seq 1811 aa AA seqDB search
MGKRKFSGLEITLIVIVCLVTVIACVLIGLLASGESGVKTAEFSPECPNILIAERIDCIP
DQISTKLTCILRGCCWSPSSDTSVPWCFFPSNHGYKVDGSTRSTQAGFEATLTRLPSPSL
FGNDINTVLLTGEYQTPNRFRFKITDPKTQRFEVPHEHVQPFTGSAASNLNYKVDVKQNP
FGIVVTRISNGRVLFDTTIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDVNWKTW
PMFSRDVGPSGEMHNLYGVQTFFLCLEDSSGASFGVFLMNSNAMEFAVQPTPAVTYRTIG
GILDFYIFLGNTPEQVVQEYVKLVGLPALPSYWSLGFQLSRFGYGSLDEVKRVVERNRAI
GLPYDAQITDIDYMEEKKDFTYDKVKFQDLPYFASYMHDYGQKYIIILDPAISIKNLVNG
SSYESYVRGESKKVWVNESNGVTALLGEVWPGETVFPDFTNPDCTSWWVEECKLFYSIVP
YDGIWIDMNEVANFVKGSKNGCAQNDLNYPPFTPRILDNLMFSKTLCMDAVQKWGKHYDV
HNLYGYSMAISTQKVINTLFPGKRSFLISRSTFAGSGKHTGHWLGDNAATWDHIKWAIPG
MLDFNLFGIPYVGADICGFFDHTTEELCRRWMQVGAFYPFSRNHNSKDLIPQDPAVFGPD
SILVKSSKHYLNIRYTLLPYLYTLFYKAHTQGDTVVRPVLHEFYSDEVTWSVDRQFLWGP
GLLISPVLDPGVDRIQAYIPDAVWYEYDKGAKIPMRKQWTSMFLPADKLGLHLRGGYIYP
TQQPANTTVASRKNPMGLIIALDDNSAASGDLFWDDGESTGTVESKAYIYYKFTVSNNVL
QMDAINSNYTDPNNLKFEEIKILGALQEITAVTVSQKNVVESSLLNITYYPLEKVAHITG
LQLELGKSYTITWTQQLSVNERFNCYPSPDPTQEKCEQLGCAWEQVTSGLDIPPCYYNSS
NAYSVDKIEYTSSGLAASLTLNSARTRANDNFTTPISTLRLEVKYHLNHMLQFKIYDYQN
TRYEVPVPLNLPSSPTSTDTERLYEVSVQKKPFGIQVWRKSTGTVIWDSQLPTFTFSDMF
IQISTRLASQYIYGFGETEHNTFRHNMSWHTWGMFTRDQPPTYKLNSYGYQPFYMALEED
GNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVVQEYTALIGRPVMP
PYWSLGFHLCRYGYRNDSEIAQLVEGMKAAGIPHDVQYADVDYMERQLDFTIGTRFAGLP
ALINRIKEEGMRFIIILDPAISGNETNYPTFSRGLRNDVFIKWPNTDNIIYSKVWPFLPN
VQINESLPEQTQIQIYGAHVAFPDFFRNSTVGWWKNEILEFYNNPTNPSSSVKFDGLWID
MNEPAAFLNGAIGGCRNDLLNMPPYIPDLGYRSDGLNVKTLCMEGQQYLPDGTPVRHYDV
HNLYGWSQTKPTLDGLQSATKERGIVITRSTYPSSGKWAGHWLGDNTAAWDQLAKSVIGM
MEFSLFGISYTGADICGFFKDSEYELCLRWMQLGAFYPYSRNHNQKGTRRQDPVSWNSTF
EEVSRNVLNIRYTLLPYLYTLMYDAHAHGSTVVRPMLHEFVEDRTTWEIYEQFLWGPALL
ISPVMQQNAVTVIAYLPNARWYDYYTDEEIGFRGQFQILPAPLDHINLHIRGGYILAWQR
PANTTFYSRKNPMGLTVALNDALFAEGQLYWDDGVRIDAYEDSVYLLTSFTANQNVLNIT
VLHHGYTDPNNLTFTDIKVLGVPTSVKQVTISQNGGMITSAHTANYYDAKKLLIITKLQL
ELGKNYTVQWS
NT seq 5436 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggaagttcagtgggctggaaatcacactgatcgtcatcgtctgcctggtg
acagtcatagcctgtgtcctcattgggcttttagcatcaggagaatccggtgtcaaaact
gcagaattttcaccagaatgtccaaacatattaatagcagagagaattgactgcatccca
gatcaaatatcaacaaagctcacctgcatcctgcgtggctgctgctggagtcccagcagt
gataccagtgtgccctggtgttttttcccttcaaaccatgggtacaaagtggatgggtca
acaagatcaacacaggcaggattcgaggctacgttaacaaggctgccatcaccttccctc
tttggaaatgatatcaacactgttctcctcacaggagagtatcagacaccaaatcgcttc
cggttcaagatcactgatcctaaaacgcaaaggtttgaagtccctcatgagcatgtgcaa
cctttcactggatccgcagcctccaatttaaactacaaagtggatgtcaagcagaatccc
tttggcatcgtggtgaccaggataagcaacggtagagtgctatttgatactaccattgga
ccactgcagtacgctgaccagtttttacagctgtcaatcaaactacctagcagcaacatt
tacggtgtgggagagcacgtgcataagcaataccgacacgatgttaactggaaaacctgg
cccatgttcagcagggatgttggcccctctggagaaatgcataacttatatggagttcaa
actttcttcttgtgcttggaagacagctccggagcctcctttggtgttttcctaatgaac
agtaatgccatggagtttgcagtgcagcccactccagcagtgacctacagaaccattggt
gggatccttgatttctatatcttcttggggaacactccagagcaagtagtccaggagtat
gtgaagcttgtgggactgccagcattgccatcctactggagcctgggcttccagctcagc
cgcttcggttatgggtctctggatgaggtgaagcgagttgtggagaggaacagggcgatt
gggctcccttatgatgctcagatcactgatattgactatatggaggaaaagaaagatttt
acatatgacaaagtgaagtttcaagatctcccttattttgcatcttatatgcatgactat
ggacaaaaatatattatcatattggatcctgctattagcataaaaaatctagtgaacggt
agttcatatgaaagctatgtcagaggagagagtaaaaaagtctgggttaatgaatcgaat
ggagtaacagcattacttggggaggtgtggccaggggaaactgtgttcccagacttcacc
aacccagactgcactagctggtgggtggaagaatgcaaactgttttatagcatagtgcca
tacgatgggatctggattgatatgaatgaagtagccaactttgttaaaggctcaaaaaat
ggttgtgcgcagaatgacttaaactatcctcctttcactccccgtattcttgataatctc
atgttttctaagacactttgtatggatgcagtacagaagtgggggaaacattatgatgtc
cacaatctttatggatattccatggccatatcaacacagaaagtcatcaatacactgttt
cctggaaaacgaagcttccttatttcacggtctacttttgctggatcaggaaagcacaca
ggacactggctgggagataatgcagcaacatgggatcacataaagtgggcgatacctgga
atgctggacttcaacctctttggaattccctatgttggagcagatatttgtggtttcttt
gaccacaccacagaagaactttgtagaagatggatgcaagtaggagcattttacccattc
tccaggaatcacaactctaaagatctcatacctcaggatccagctgtgtttggacctgat
tccatcttggtgaaaagctccaagcattacttgaacattcgctacactttgctgccctac
ctgtatacactcttctataaagctcatactcaaggagatacagttgtgcggccggttttg
catgagttctactccgatgaagtgacgtggagtgttgacaggcagttcctgtggggtcct
gggctgcttatttcccctgtacttgacccgggtgtggacagaattcaagcatatattcct
gatgctgtgtggtatgagtatgataagggggcaaaaatcccaatgagaaaacaatggacc
agtatgttcctgccagccgacaaactgggactccacctgagaggtggctatatttaccct
actcaacaaccagctaacacaacagttgcaagccgcaagaatcccatgggactgataatt
gccctggatgacaacagtgcagcttctggggacttgttctgggatgacggagaatctaca
ggtacagttgagagtaaagcctacatttactacaagtttacagtttccaataatgttcta
caaatggatgctataaacagcaattatactgatccaaacaatctgaaatttgaagaaatc
aagatactgggagcgctccaggaaataacagcagttactgtatctcagaaaaatgttgtg
gaaagttctctgcttaatatcacctattatcctttagaaaaggttgctcatataacagga
cttcagcttgaactgggaaaatcttacacaataacatggactcaacaactgagtgtcaat
gaaaggtttaattgttaccccagtcctgacccaacacaagaaaaatgtgaacaacttggc
tgtgcttgggaacaagtaacatcaggcttggatattccaccctgctattacaactccagc
aatgcttactctgtagacaaaatagaatacacctcgtcaggtttggcagccagcctcacc
ttaaacagtgccaggaccagggccaatgacaatttcactacaccgattagtacactacgc
ttggaggtgaaatatcatctcaaccacatgctgcaatttaagatttatgattatcaaaac
acacgatatgaggttccggtaccactaaatctcccgagctccccaacaagcactgatacg
gaacgactctatgaagtatcagttcagaaaaaaccatttggtatacaagtttggcgcaaa
agcacaggaacagtcatctgggattcacagctgcccaccttcacattcagtgacatgttc
attcagatttctacccgcttagcatcccagtatatatatggatttggagaaactgagcac
aatacatttcgacataacatgagctggcatacctggggaatgttcacaagggaccagcct
cctacttacaagttgaattcctatggttatcagccattttacatggctcttgaagaagat
ggcaatgcccatggagttcttttgcttaacagcaatgcaatggatgtgacattccagcca
acccccgccctgacatatcgcaccactggtggaattcttgacttctacatggttttgggc
ccaacgccagaacttgttgttcaggagtacactgcactgattggacgaccagtcatgcca
ccttactggtctttgggattccacttgtgccgctatggatacaggaatgactcagaaatc
gcccagctggtggagggcatgaaggcagctggaattccccatgatgtccaatatgcagat
gttgactatatggaaaggcaactggacttcaccataggcacacgctttgctggattacca
gctctgatcaacagaataaaagaagaaggaatgcgatttataattatcctggatccagcc
atctctggaaatgaaaccaattatcctactttctcaagaggtctgcggaatgatgtcttc
ataaaatggcccaatactgataacattatatattccaaggtctggccatttcttcccaat
gtacaaatcaatgagtcactgcctgagcaaacccaaatacagatctatggagcacatgtt
gctttcccagacttcttccgcaattccactgtggggtggtggaagaatgaaatcctggag
ttctacaacaatcccaccaacccctccagcagtgtcaagtttgatggcttgtggattgac
atgaatgaaccagcagcttttctgaatggtgccattggcggatgtagaaatgacctccta
aatatgccaccatacatacctgatttgggataccggtcagatggattaaatgtcaaaact
ctatgcatggaaggtcaacaatatctgccagatggtaccccagttagacactatgatgta
cacaatctttatggatggtcacaaaccaaacctaccctggatggtttgcagagtgctacc
aaggagcgtgggatcgttatcacccgttccacatatcccagtagtggaaaatgggcagga
cactggcttggtgataacactgcagcttgggatcagctagctaaatctgttatcggtatg
atggagttcagtctctttggaatatcttatacaggagctgatatctgtggcttcttcaaa
gactcggagtatgagctgtgtcttcgctggatgcagctgggcgcgttttatccatattcg
aggaatcacaatcagaaaggaacacggaggcaagatcctgtttcgtggaactcaactttt
gaggaggtttccaggaatgtgctgaatataagatataccctgttaccttatctgtacacg
ttaatgtatgatgcccatgcccatggcagcactgtggtccgccccatgctccatgagttt
gtagaagacagaaccacctgggaaatatatgagcaattcctttggggacctgcactgctc
atcagccctgtgatgcaacagaatgctgtaacagtgattgcttacttacccaatgcccgc
tggtatgattactacacagatgaagagattggctttaggggacaattccaaattttacca
gctcctttggaccatatcaacctgcatatccgaggtggatacatccttgcttggcaaaga
cctgctaatacaactttttacagccgaaaaaacccgatgggactcactgtggctttgaat
gacgccctgtttgcagaaggacagctttattgggatgatggggttcgcattgatgcatat
gaagacagtgtatatctgctaacatcattcaccgctaatcagaatgttttaaatatcacg
gttttgcatcatggttacactgatccaaacaacttaacatttactgacattaaagtcctg
ggggtgcccaccagcgttaagcaggtgacaatatcacagaatggtgggatgatcacatca
gctcacactgcaaactactatgatgccaagaagttgctgataatcacgaagcttcagctt
gaattaggcaaaaactacactgtgcaatggagctaa

DBGET integrated database retrieval system