KEGG   Falco cherrug (Saker falcon): 102047110Help
Entry
102047110         CDS       T02911                                 

Gene name
SLC35B2
Definition
(RefSeq) adenosine 3'-phospho 5'-phosphosulfate transporter 1
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fch02000]
    102047110 (SLC35B2)
Transporters [BR:fch02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   102047110 (SLC35B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA CRT-like TPT DUF983 MNHE
Motif
Other DBs
NCBI-GeneID: 102047110
NCBI-ProteinID: XP_027661044
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MATGEEIPPALQDSWGDFWLFRFFVNAAGYASIVVPGFLLIQYFKRRNYLETGRGICFPV
IKSCVFGSEVKSVHQEDGSLPPRAEPTESSTARQVFKLLCCAAGLQASYLTWGVLQERVM
TRTYGATETDPGEKFKDSQFLVFMNRILAFTVAGLYCALTKQPRHGAPMYKYSFASLSNI
LSSWCQYEALKYISFPTQVLAKASKVIPVMMMGKLVSRKSYEYWEYLTAALISVGVSMFL
LSSAPNRHASTVTTFSGIVLLAGYIIFDSFTSNWQDALFTYKMSPVQMMFGVNVFSCLFT
VGSLLEQGALLESVRFMARHSEFTAHAVLLSVCSACGQLFIFYTINQFGAAVFTIIMTLR
QAFAILLSCLIYGHTVTVVGGLGVAVVFMALFLRVYARSRMKKRSKKLPPGETPVQKV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctactggtgaagagataccccctgccctgcaggactcgtggggggacttctggctc
ttccgtttctttgttaatgctgctggctatgcaagtattgtggtgccgggattcctcctc
atccagtacttcaagagaaggaattacctggagacaggcagaggcatttgcttccctgtc
atcaaatcatgtgtgttcggctctgaggtgaagtctgtacaccaggaagacggctcccta
ccacctcgagcagagcccacagagtcctctacagcccgacaggtcttcaagctgctctgt
tgtgctgctggtctacaggcctcctacctcacatggggcgtcctccaggagcgtgtgatg
acaagaacatacggtgccaccgaaacagaccctggtgagaagttcaaggactcccagttc
ttggtgttcatgaaccgcatcctggccttcacagtggctggtctgtactgcgccctgacc
aagcagccgcgccacggggctcctatgtacaaatactcctttgcctccctctccaacatc
ctcagcagctggtgccagtatgaggcactcaaatacatcagcttccccacccaagtgcta
gccaaggcctctaaagtgatcccagtgatgatgatgggcaaactggtgtcacgcaaaagt
tatgagtactgggaatacctaactgctgccctcatctccgtgggggtcagcatgttcctg
ctctccagtgctcccaacaggcacgcatctactgtcaccacgttctcgggcatagtcctc
ctggctggctacataatctttgacagcttcacctccaactggcaggatgccctcttcacc
tataagatgtctcctgtgcagatgatgtttggcgtcaatgtcttctcttgccttttcacg
gtgggctcactcttggagcagggtgccttgctggagtcggtacgcttcatggcccgccac
tcagagttcacggcccatgccgtgctgctctctgtgtgctctgcctgtggccaactcttc
atcttctacaccatcaaccagttcggggcagccgtcttcaccatcatcatgacactccgc
caggccttcgccatcctcctttcctgcctcatctacgggcacactgtcactgtcgtgggt
gggctgggcgtagctgttgtcttcatggccctcttcctccgcgtctatgcccgcagccgc
atgaagaagcgcagtaagaagctcccaccaggcgagacccccgtacaaaaggtctaa

DBGET integrated database retrieval system