KEGG   Falco cherrug (Saker falcon): 102047195
Entry
102047195         CDS       T02911                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00230  Purine metabolism
fch01100  Metabolic pathways
fch04020  Calcium signaling pathway
fch04114  Oocyte meiosis
fch04261  Adrenergic signaling in cardiomyocytes
fch04270  Vascular smooth muscle contraction
fch04371  Apelin signaling pathway
fch04540  Gap junction
fch04912  GnRH signaling pathway
fch04914  Progesterone-mediated oocyte maturation
fch04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102047195 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102047195 (ADCY3)
   04020 Calcium signaling pathway
    102047195 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102047195 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102047195 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102047195 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102047195 (ADCY3)
   04916 Melanogenesis
    102047195 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102047195 (ADCY3)
   04270 Vascular smooth muscle contraction
    102047195 (ADCY3)
Enzymes [BR:fch01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102047195 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4
Other DBs
NCBI-GeneID: 102047195
NCBI-ProteinID: XP_027667322
LinkDB
Position
Unknown
AA seq 1123 aa
MPRNRAFSEPECSAEYSADYSVSLPSDPERGVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLVMCAVVYTADKLAPLLAAAAGLVAHVL
LFILCKYRLLPERVARRFLPYILWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAISCGIHTLVLGVTIAQQRQDALDEGTLLRQILSNVAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPEYREDHAVCSIMMGLAMVEAISXVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIITYLVVVPKQPLRNGINGVKLSLTSSHGGXHAXXXXXXXXXACASPEEPEEPD
TRVRGTLESGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALLERES
VQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDPWLVA
NYVTFIVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIIIVTMA
DIVDMLSCWQDHGGTGNGTVGPLRPGGCGEQPKYYSYIALLALVATIMLVQVSHMVKLTL
MVLITGATGAVNIYAWEHIFDQYDRHRGQQSTSLLVPSKYSMTAMIFIVMLSFYYFSRHV
EKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYD
EIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGST
YMAASGVTPDANANGYTTKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFNNFMLR
IGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEYGFRFV
RRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggctttttccgagcccgagtgctcggccgagtactcggcagactac
tcggtgagcctgccgtcggaccccgagcgcggcgtgggtcgcacccacgaggtgacggtg
cgcagctcgggaccctgcctctgcctgccccgcttcatgcgcctcaccttcgctcccgag
tccctggagaacctctaccagacttacttccgccgccaacgccacgagaccctcctggtg
ctggtggtctttgccgccctcttcgactgctacgtcctcgtcatgtgcgccgtggtctac
accgccgacaagctggccccgctgctggcggcagcggccgggctggttgcccatgtgctg
ctcttcatcctttgcaagtacaggctgcttcccgagcgggtggcccgcaggttcctgccc
tacatcctctgggtcctcatcttggcccagatcttctgctacctgggtctcaacttctcc
cgctcgcccgaggccagcgacacggtgggctggcaggctttcttcgtcttctccttcttc
atcactttgccgctgcgcttggcgcccatcgtgctcatcaccgccatctcctgcggcatc
cacacgctggtgctcggtgtcaccatcgcccagcagcggcaggatgccctggacgagggg
acgctgctgagacagatcctgtccaatgttgccatctacctttgtgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaagccttccttgaagcacgccag
tcccttgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcacgtggccgatgagatgctgaaggacatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctcttcgcagacattgtgggcttcacccagctgtcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaatgagctcttcgcccgcttcgacaagctggcagccaaataccaccag
ctgcgcatcaagatccttggtgactgctactactgcatctgcgggctgcccgagtaccgg
gaggaccacgccgtctgctccatcatgatggggctggccatggtggaggccatttcgtan
gtgcgggagaagaccaagacggcggtggacatgcgggtgggggtgcacagtgggacagtg
ctggggggggtgctgggccagaagcgctggcagtatgacgtgtggtccaccgacgttacc
gtggccaacaagatggaggcaggcggcatccctgggcgggtgcacatctcgcagagcact
atggattgcctgaagggtgagttcgaggtggagccgggtgaaggtggctcacgctgcgag
tacctgaaggagaagggcatcatcacctacctcgtcgtggtccccaagcagcccctgcgc
aacggcatcaatggggtgaagctgtcgctgacctcatcccacggtgggntacacgcnnnn
nnnnnnnnnnnnnnnnnnnnnntggcctgcgccagccccgaggagcctgaggagcccgac
accagggtgaggggcaccctggagagcggggaggaggatggagaggccgtgaacccctcc
ttccccaaccctcggcggcggctgcgattgcgggacctggccgagcgcgtgatcgatgcc
tcgcagaacgagcaggagctcaacaagctgctcaatgaagccttgctggagcgcgagtcc
gtgcaggcgctgaaggggaagagcaccttccgactctccatgcgcttcattgaccccgag
atggagacgcgctactcggtggagaaggagaagcagagcggagccgccttcagctgctcc
tgcgttgtcctcttcttcactgctttggtagaggtcttcattgacccctggttggtggcc
aactacgtgactttcatagtcggggagatcctcctgctcatcctcaccctctgctcgttg
gctgccatcttcccccgggttttccctaaaaagctcgtggccttctccacctggattgac
aggacccgctgggcacgcaacacctgggccatggccgccatcatcatcgtcaccatggct
gacatagtggacatgctcagctgctggcaggaccatggcgggacaggcaacgggacggtg
gggccactgcggccaggcggctgtggggagcaacccaagtactacagctacattgccctg
ctggccttggtggccaccatcatgctggtgcaggtcagccacatggtcaagctgaccctc
atggtgctgatcactggggccaccggcgctgtcaacatctacgcctgggagcacatcttt
gaccagtatgaccgccaccgtggtcagcaaagcacgtccttgctggtcccctccaaatac
tccatgacagcgatgatcttcatcgtgatgctcagcttctactacttctctcgtcatgtg
gagaagctggccaggacccttttcctctggaagattgatgtccatgaccagaaggagcgg
gtctatgagatgcggcgctggaatgaggctcttgtcaccaacatgctgcctgagcacgtg
gcccggcacttcctgggctccaagaagcgggacgaggagctgtacagccagtcctatgat
gagattggtgtcatgtttgcctccctccccaactttgccgacttctacacggaggagagc
atcaacaacgggggcattgagtgcctgcgcttcctcaacgagataatctccgacttcgac
gcgctcctggacgaaccccagttccgctgcatcaccaaaatcaagaccatcggcagcacc
tacatggcggcttctggagtgacccctgatgccaacgccaacggctacaccaccaagaag
gagaccctctcggataaggagcgctggcagcacttggccgacctggccgactttgcctta
gccatgaaggtgacactgatgaacatcaactaccagtccttcaacaacttcatgctccgc
ataggcatgaacaagggggccgtgctggcaggtgtcattggtgcccgcaagccacactac
gacatctggggcaacacggtcaacgtggccagcaggatggagtccaccggcgtgatgggg
aacatacaggtggtggaggagacccacctcatcctgaaggagtacggcttccgctttgtt
cgccggggagccatctacgtcaaaggcaaaggggagctgctcaccttcttcctcaagggc
cgggagaagcagggctcctttgtcaatggctcctccgtcaccctgccccaccaggtggtg
gacagctcctga

DBGET integrated database retrieval system