KEGG   Falco cherrug (Saker falcon): 102047706Help
Entry
102047706         CDS       T02911                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00020  Citrate cycle (TCA cycle)
fch00190  Oxidative phosphorylation
fch01100  Metabolic pathways
fch01200  Carbon metabolism
Module
fch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fch_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102047706 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102047706 (SDHA)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102047706 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4
Motif
Other DBs
NCBI-GeneID: 102047706
NCBI-ProteinID: XP_014139235
LinkDB All DBs
Position
Un
AA seq 551 aa AA seqDB search
MEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAF
GGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIRE
GRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAE
TCKPGEPVPSIKPNAGEESVANLDKLRFANGTIRTSEVRLNMQKAMQNHAAVFRTGSVLQ
EGCEKLSQIYSDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKLRIDEFDYSKPLQGQQRKPFEEHWRKHTLSYVDIQSGKVTLKYRPVIDRTLNEED
CSTVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgataactggaggtggcatttctatgacacagtgaaagggtctgattggctg
ggtgaccaggatgccatacactacatgactgagcaagccccggctgcggtgatagagctg
gaaaattatgggatgccgttcagcagaactgaagaaggaaaaatctatcagcgtgcattt
ggtggacagagtcttcagtttggaaaaggaggacaggctcacagatgctgttgtgttgca
gacaggacaggacactcactgttacatactctgtatggcaggtccctaagatacgataca
agctactttgttgaatattttgccttggacctccttatggagaatggagaatgtcgtggt
gttattgccctttgcatagaagatggcactatacatcgtttcagagcaaagaacactgtc
attgccacgggtgggtacggccgcacttacttcagttgtacatctgctcatactagtaca
ggtgatggcactgctatggttacacgagctggtcttccatgccaggacttggaatttgta
cagtttcaccctacaggtatctatggggctggctgccttataacggaaggatgtcgtgga
gagggaggtattctaattaacagtcaaggggaaagatttatggagagatacgcacctgtt
gctaaggatctggcttccagggatgtagtgtctcgttctatgaccatagaaatccgtgaa
ggaaggggttgtggtcctgaaaaagaccatgtatacttgcagttgcaccacctaccacca
cagcagctagcaacccgtctcccaggaatttcggaaacagctatgatatttgctggagtt
gatgtcactaaagagcctattcctgttctgcctactgtgcattataatatgggaggtatt
cctactaactacaaaggacaggtcattacacatgtgaatggtgaggataaagtcgtacct
ggtttatatgcttgtggggaagcagcctctgcatctgtccatggcgcaaatcgacttgga
gcaaactcacttctggatttagtggtttttggtcgtgcttgtgcccttactattgcagag
acatgcaagcctggagagccagttccctccattaaaccaaatgctggtgaagagtcagtt
gctaatcttgacaaattaagatttgctaatggaaccataagaacttcagaagtgcgactt
aacatgcagaaggcaatgcaaaaccatgctgctgtatttcgtactggttctgtactccaa
gaaggctgtgaaaaacttagccaaatttatagtgatctggctcatctaaagacatttgac
agaggtattgtgtggaacactgacttggtggagacccttgaactgcaaaacctgatgctt
tgtgctctacaaaccatttatggtgcggaggctcgcaaagaatcccggggtgctcatgcc
agagaggactataagttacggatagatgagtttgactattctaagccactccaaggccaa
cagcggaagccatttgaagagcactggagaaagcacaccctttcatatgtggatatacaa
tctgggaaggttaccctgaaatacagacctgtgatcgacagaacgttgaatgaagaagac
tgctcaactgtcccacctgctattcgctcatactag

DBGET integrated database retrieval system