KEGG   Falco cherrug (Saker falcon): 102048023
Entry
102048023         CDS       T02911                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00220  Arginine biosynthesis
fch00330  Arginine and proline metabolism
fch01100  Metabolic pathways
fch04020  Calcium signaling pathway
fch04146  Peroxisome
fch04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102048023 (NOS2)
   00330 Arginine and proline metabolism
    102048023 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102048023 (NOS2)
   04020 Calcium signaling pathway
    102048023 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102048023 (NOS2)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102048023 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 102048023
NCBI-ProteinID: XP_014135956
LinkDB
Position
Unknown
AA seq 1158 aa
MLCPWQFVFKARAAKNESSEEKDINNNVEKDRKIHGLGNDDAKLHDLSKKQIEMPPIAAS
AKASGGKENPPPNGVKASNQILRCPRHIKVRNLGNGSSFLDTLHLTAKEVINCRTKACQG
ALMTPKGMVRGTRDGPVPPAELLSQAVDFIKQYYSSFKEPKKEEHLVRLEAVTKEIETTG
TYHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIQYATNN
GNIRSAITVFPQRTDGKHDFRIWNSQLIRYAGYQMPDGSIIGDPASVEFTQLCVELGWKP
KYGCFDVVPLILQANGQDPEIFEIPPEIVLEVPMEHPKFEWFKELDLKWYALPAVANMLL
EVGGLEFTGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLYSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPKKKEIKFSILAKAVLFASSLMRQTMATRS
KVTVIYATETGKSETLANNLCSLFNCAFNTKILCMDEYNICDLEKETLLLVVTSTFGNGD
SPNNGKTFKNSLLTLKFLRGKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPIG
EGDELNGQEAAFRAWAVSAFKTACDIFNICGKNSIQLPEIYTSDESWDPKNYRIVHDSQT
MDLAKALANIHAKVIIPMKLKFRQNLQSLKSSRVTILVKLSCETNQGMHYLPGDHIGIFP
GNQPELVHGLIAHVKDAPPADQTIRLETCTGGGYWTSDKKIPACTLLEALTYLLDITTPP
SQQLLKKLAQLVTAEEDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLL
TQLPFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNTIALNEIV
PCFIRSANEFRLPEEPTKPCILIGPGTGIAPFRSFWLQRLHDLEKKGIKGGDMTLLFGCR
QPDMDHIYKEETDEMKRKGVLKEVYTAYSRQPGQPKVYVQDILQSKLETKVCNLLHKEEG
HLYVCGDVHMAKDVAQTLKGLLAKYLNLNEQQAEEYFFQLKSQKRYHEDIFGAAFPHDVK
RGVRALQPTSPRTNQLMF
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgttgtgcccatggcagtttgtgttcaaagctcgtgctgctaagaatgagtcctctgaa
gagaaggatatcaataataatgtggagaaagataggaagatccatggcttaggaaatgat
gatgccaaattacatgatctgagcaagaagcagatagagatgccgcctattgcagcttca
gcaaaggccagtggtgggaaagagaatccccccccaaatggtgtcaaagcttcaaaccaa
atattaagatgtccaagacacataaaagtaagaaacttgggaaatggatccagctttctc
gacacactacacctgacagcaaaggaggttatcaactgccggaccaaagcctgccaaggg
gcactcatgacgccaaagggcatggtgagaggtacaagagatgggccagttccaccggca
gagcttttatctcaggcagtagactttatcaagcagtactacagttcatttaaagagcca
aaaaaagaagaacacctggtccgactggaagcagtgaccaaggagatagaaacaacagga
acctaccatctgacaaaggatgaactgatctttgctgccaaacaggcctggaggaatgca
cctaggtgtattgggagaatccagtggtccaatctacaggtatttgatgcacgtgattgt
aaaacagcaaaagaaatgtttgagcatatctgtcgtcatattcagtatgccacaaataat
ggaaatataagatcagccattactgtcttcccccagaggactgatgggaaacatgatttt
cgtatttggaacagccagctcatccgatatgctggatatcaaatgccagatgggtctatc
ataggagaccctgccagtgtggagttcacacagttgtgcgttgagcttgggtggaagccg
aaatatggctgctttgatgtagttccactcattctccaagcaaacggccaagacccagaa
atatttgaaatcccgccagaaattgtgctcgaagtgccaatggagcatccaaagtttgaa
tggtttaaggagttagatctgaagtggtatgcactgcctgctgttgccaacatgcttctt
gaggtgggaggcctggagtttactgggtgtcctttcaatggctggtacatggggacagag
ataggagtgcgagacttctgtgatgtacagcgatataatatcctaaaggaggtagggaga
agaatgggactggaaacaaacaaactttcatcgttatggaaagaccgagctgttgtagag
ataaatgtggctgtgctttatagcttccaaaaacaaaatgtgactatcatggaccaccac
tcagctgctgagtccttcatgaaatacatgcagaatgagtaccgtgtacgaggaggctgc
ccggctgactgggtgtggattgtgcctcccatgtcagggagcataactcctgtgttccac
caggagatgttgaactatgtcctcactcccttctattactaccaggtggatgcatggaaa
acgcatgtctggcatgatgagacccggagaccaaagaaaaaagaaataaaatttagcatc
ttggcaaaggctgtactttttgcatcttcactcatgcgacaaacaatggcaaccaggtcc
aaggtcactgtaatctatgcaacagagactgggaaatctgaaacactagcaaacaatctt
tgcagcttgttcaactgtgccttcaacactaagattctgtgcatggatgagtacaacatt
tgtgacctggaaaaagaaacgcttcttttagtggttactagcacttttggaaatggagat
tctccaaataatggaaagaccttcaagaactccttgctcaccctgaaatttctgagagga
aaaattagatatgctgtgtttggtttggggtccagcatgtatccagagttctgtgctttt
gctcatgccattgaccaaaaactggcccaactaggggcttctcagctcactccaataggc
gaaggagatgaactcaacgggcaagaagcagcctttcgcgcatgggcagtcagcgcgttc
aagactgcctgtgacatttttaacatctgtgggaaaaacagtattcagttgcctgagata
tatacctctgatgaaagctgggatcctaagaattacaggatagtccatgactctcagacc
atggacttggctaaagcacttgcaaacattcatgccaaggttataattcccatgaagctg
aaattcagacagaatcttcaaagtttaaagtccagtcgtgttaccattctagttaagctt
tcctgtgagactaatcagggcatgcactacctgcctggagatcatatcgggattttccca
ggcaaccagccagaattagtccatggcctcattgcccatgtcaaggatgcccctccagct
gatcagactatcagacttgaaacctgcactggtggtggctactggacgagtgacaaaaag
attcccgcctgcacactcctggaggctttgacatacttgctcgatatcactactccaccc
tcccaacaactgctaaaaaaacttgcccagctggtaacagcggaagaagacaaacagaga
ctggaagttttatgtcagagcacagaagaatacaataaatggaagttttacaacagcccg
aacatcctggaggtcctggaggagtttccttctgctgaggtctcaacagctttcttactg
actcagctgccatttctgaaacccaggtactattccgtcagttcctcctgtgacatgaca
gccagagagattcatctgacagttgcagtcgtaaactacaggacgagagatggacaaggg
cctttgcaccatggagtctgcagcacgtggctgaatacaatagctctcaatgaaatagtg
ccatgctttatacgcagtgctaatgaattccggctcccagaggagccaaccaagccatgc
attctgatcggtcctggaacaggaattgctcccttcagaagtttctggctgcagcgtctc
catgacttggaaaagaaagggatcaaaggtggtgacatgacattattgtttggctgccgg
cagccagacatggatcacatctacaaagaagaaactgatgagatgaagaggaagggagtc
ctgaaagaagtctatacagcttactccagacaacctggccaacctaaggtctatgttcaa
gacatccttcaaagcaagttggagaccaaagtgtgcaacctcttgcataaggaggaaggg
catctgtatgtctgtggggatgtacacatggccaaggatgttgctcagactttgaaaggg
ctgctagcaaaatacctgaatcttaatgagcaacaggcagaggagtacttcttccagcta
aagagccaaaagcgttaccatgaagatatatttggggctgcattcccacatgatgtcaaa
agaggtgtaagagctttgcaacccaccagtccaagaacaaatcaacttatgttttag

DBGET integrated database retrieval system