KEGG   Falco cherrug (Saker falcon): 102048150
Entry
102048150         CDS       T02911                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04020  Calcium signaling pathway
fch04260  Cardiac muscle contraction
fch04261  Adrenergic signaling in cardiomyocytes
fch04270  Vascular smooth muscle contraction
fch04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102048150 (CACNA1C)
   04020 Calcium signaling pathway
    102048150 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102048150 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102048150 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102048150 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102048150 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fch04040]
    102048150 (CACNA1C)
Ion channels [BR:fch04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102048150 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102048150
NCBI-ProteinID: XP_027663375
LinkDB
Position
Unknown
AA seq 2203 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRSTPAGLPDKKKGKFA
WFSHSTETHVSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRRWNRFCR
RKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLK
MYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYW
NSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKAAVEEETKEEKIELKSITADGE
SSPATKINMDDYQPNENDEKSPYPTSEVPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPM
PDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQILF
YFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGK
LYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWENSKFDFDNVLTAMMALFTVSTF
EGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGE
QEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTI
CLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGS
IIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISIT
FFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIA
LNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHS
CGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDP
EAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALV
RTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQE
YFRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDTE
SPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPT
ICVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDEAYDENLNEDIEYCSEPS
LLSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQG
VDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPPATPCSRGWPQQTIPT
LRLDRAESSEKLNSSFPSVHCSSRYPDNTGCSSPRRARPVSLTVPSQTGGSSRQFHGSAG
SLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNL
LPFVNCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6612 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattcccgaagaaaaccatcaaggttccaactat
gggagtccccgtccagctcatgccaacatgaatgccaatgcagctgcagggcttgcccca
gagcatatccctactccaggggcagcgctgtcctggcaagctgcaattgatgctgccagg
caagccaaactgatgggtagtgctggcaatgcaacaatatccacagccagctccacgcag
aggaaacggcagcagtatggaaaacagaaaaaacagggtactaccacagctacacgtcct
ccccgagcactgctgtgtttaacactgaaaaatcccatccggagggcatgcatcagcatc
gtcgaatggaaaccatttgaaataattatattactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggagtatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggatttgatgttaaagcactgcgggctttcaga
gtattacgtccattacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcacattgccctgctggtgctgtttgtcattatt
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctaccat
gttcaagggggactgatagatacacctgcagaagatgatccatctccctgtgccccccag
tctgcgcatgggcggcagtgtcagaatggcacagagtgcaaagcaggctgggagggacct
aagcacggcattacgaactttgacaattttgcttttgccatgctgacggtgtttcagtgc
atcacaatggagggctggacagatgtactgtactggatgcaggacgctatgggctatgag
ttaccatgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctg
gttcttggtgtgttgagcggggagttttccaaagaaagagagaaggctaaggctcggggt
gatttccagaagttacgggaaaaacaacagctagaggaggatttgaagggatacttagac
tggataactcaagcagaagatattgacccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacagaagcactccagctggcttgcctgataagaagaaaggaaagtttgct
tggtttagtcactccacagaaacccatgtgagcatgcccaccagtgagaccgagtccgtg
aacacagacaacgtccctggagcagatattgaaggcgaaaactgcggtgctaggctagcg
catcggatctcaaaatcaaagtttagtcgctactggcgccgatggaatcgattctgcaga
agaaagtgccgtgccgctgtcaagtccaatgttttctactggttggtgatcttccttgtg
tttctcaacacccttaccattgcctctgagcactacaaccagccagactggctcacggag
gtccaagacactgccaataaggtgctgctagctctgttcacggcagagatgctgctgaag
atgtacagccttggtctccaggcctattttgtgtccctcttcaaccgctttgactgtttc
attgtatgtggaggaatcctggaaactattctggttgagacaaagatcatgtcaccactg
ggcatttcggtgttgagatgtgttcgactcctaagaatatttaaaatcacaagatactgg
aactccctcagtaaccttgtggcttcactcctgaattcagtccgctccattgcctccctg
ttgctgcttctcttcctcttcattatcatcttctctctcctggggatgcagctctttggg
ggcaagtttaattttgatgagatgcagaccaggaggagtacattcgacaacttccctcag
tcactcctcactgtgtttcagatcctgactggggaggactggaattcggtgatgtatgat
gggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttacttcatc
atcctcttcatctgtggaaactatatcttactgaatgtatttttggccattgctgtggac
aaccttgctgatgctgagagtttaacatctgcacagaaagaggaagaagaagaaaaagaa
aggaagaagctagctaggactgctagtccagaaaagaaacaggagatagaaaaagcagct
gtggaggaggagacaaaagaggagaaaattgagctgaaatcgatcactgctgatggagaa
tcctcacctgctaccaagatcaacatggatgattatcaacccaatgaaaatgacgaaaag
agcccatatcccacatcagaagtgccagcagaggaagatgaggaagaacccgagatgccc
gtcggccctcggcctcgcccgatgtctgagctgcacctcaaggaaaaggctgtgcctatg
cctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccactgccat
cgaatcgttaacgataacattttcaccaacctgatcctatttttcatcttgctcagcagc
atctccctggcagctgaggaccccgtccgacacctctcctttaggaaccaaattctcttt
tattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatgactgcg
tatggggctttcctccataagggctctttctgcagaaactatttcaacatcttagacctg
ctggtggtcagcgtttctctcatctcctttgggatccagtccagtgccatcaatgtggtg
aagatcctgcgtgttctgcgagtccttagacctctgagggccatcaacagagccaaagga
ctaaagcatgtggtccagtgtgtgtttgtcgccatccgaaccatcggaaacattgtgatt
gtcaccactttgctgcagttcatgtttgcctgcattggagttcagttgtttaagggtaag
ctgtacagctgcactgatagctccaagcagacggcagcagagtgcagagggtactatatt
acatacaaagacggtgaggtcaaccagccgatgatacagccccggagctgggagaacagc
aagtttgactttgacaacgtcttgactgccatgatggccctcttcactgtctcaaccttt
gagggctggccagagttgctgtataggtccattgattcccacatggaggatgtgggaccc
atctataatcacagggttgagatctccatcttctttattatctacatcatcatcattgct
ttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaa
caagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagaatatgccctg
aaagcccggcctctgcggagatacatccctaaaaaccagtaccagtacaaagtttggtat
gtggtcaactccacctattttgaatacctgatgttcgttctgattctgctgaacaccatc
tgcctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaatatcctc
aacatgctcttcactggcctcttcactgttgagatggtcctgaaattaatcgctttcaaa
cccaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagc
attatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaatacattt
gacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagct
gaacatacccaatgctcttcctctatgaatgcagaggaaaactctcgcatctcaatcacc
ttcttccgactcttccgcgtgatgcgtctcgtgaagctcctgagccgaggggagggcatc
cggacactgctttggaccttcatcaagtccttccaggctctcccctatgtggctctttta
atagtgatgttgttcttcatctacgctgtgatcgggatgcaggtgtttggtaaaattgcg
ctgaatgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaggcagtg
ctgctgcttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcatgtctc
ccagacaagaagtgcgacccagagtcagagccagccaactccaccgaagccgatcactct
tgtggcagcagcttcgccgttttctatttcatcagcttctacatgctctgtgccttcctg
atcatcaatctttttgtagctgttataatggataactttgattacctgacacgggactgg
tccattttaggaccacaccacctggatgagtttaaaagaatctgggcagagtatgaccct
gaagccaagggacggatcaaacacttggacgtggtgacgctgctccggcggattcagccc
cccctgggcttcgggaagctctgccctcaccgggtggcttgcaaacgccttgtctccatg
aatatgccactgaacagtgatgggaccgtcatgttcaatgccactctctttgcgttagtc
agaacagcattgaggatcaagacagaaggtaacctggagcaagccaacgaagagctgaga
gcaataattaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgccc
cccgcaggcgatgacgaggtgaccgttggaaagttctatgccacttttctgattcaggag
tacttccggaagttcaagaaacgtaaagaacaggggctggtgggcaagccctcccagcgc
aacgcactgtccttgcagtttgctgttttgcaggctggcctgcgcacacttcatgacatt
gggccagagatccgacgagcaatttctggagacctgacagctgaagaagagctagataag
gccatgaaagaagctgtttctgctgcctctgaagatgatatcttccggagagctggaggc
ttgttcggaaaccatgtcagctattaccaaagtgatggcaggagtgcgttcccccagaca
ttcaccacccagagacctttgcacatcaataagtctggcaacaaccagggagataccgag
tctccatctcacgagaagctggtggactccaccttcactcccagcagctactcatcttca
ggctccaatgccaacatcaacaatgccaacaacactgccctgtgccggttccccagccca
cccagctaccccagcactgtcagcacagtagaaggccatgggacccccttgtcacccacc
atatgtgtgcaggaggctccttggaaactaccttccaaaaggacccattactacgaaaca
ctgggacgctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtct
caggatgaggcttacgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagt
ctgctctctaccgaaatgcttgcataccaagatgatgaaaacagacaacttactccacca
gaaaacaacaaaggagaggacacccggcactctccgaagaaagggtttctgtgctcttca
gcgctaggtcgaagagcatcttttcacttagagtgtctgaaaagacagaaaaaccagggt
gtagatgtctcgcagaagacagttctgcctttgcatctggtacatcatcaggcattagca
gtggccggcctgagtcccctactccagcgaagccattcccccaccatgttctctcggctg
tgtgctacaccccctgctacaccctgcagccgtggctggccgcaacagaccatcccgact
ctgcgcctcgacagggcagagtccagcgagaagctcaacagcagcttcccgtcagtacac
tgcagctctcggtaccctgacaacaccggctgcagcagccccaggagagccaggccagtc
tccctcaccgtccccagccagactggagggagcagcaggcagtttcacggcagcgctggg
agcctggtcgaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaag
ttcattgaggtcacaacccaggagcttgcagacgcctgtgacatgacgatagaagagatg
gaaaatgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctc
ttgccttttgttaactgcagggacccagggcaggacagtgcaggagaggaagaggaagag
gtgcagaacccggattgtagaataagtcaggaggagctcaaggacagcaggatttatatc
agcagcctgtag

DBGET integrated database retrieval system