KEGG   Falco cherrug (Saker falcon): 102048155Help
Entry
102048155         CDS       T02911                                 

Gene name
NUB1
Definition
(RefSeq) NEDD8 ultimate buster 1
Organism
fch  Falco cherrug (Saker falcon)
SSDB OrthologParalogGFIT
Motif
Pfam: Ubiquitin_5 UBA HOIP-UBA UBA_4 ubiquitin TPR_12 TPR_2
Motif
Other DBs
NCBI-GeneID: 102048155
NCBI-ProteinID: XP_005442352
LinkDB All DBs
Position
Unknown
AA seq 612 aa AA seqDB search
MAQKKYLIAKLTSCLREDKIQLWKPPYTNEKKEAGKEMKELVQKYSSKLNINENDTENML
EEIRCKAIERGTGNENFKVTGIARLDIYLPRKKSRKIPLETNLFITGKELRSQIAQEHAL
KENVIKIIINKKQLDLGKTLEDQGVTHNAKVMVLQLEQSDEETKRRVQEEELQCKKEKEI
NEKMQRTKKGLEILAEREEYLDADSVPYLDIANQTGRSIEIPPQAKKALVLAMGYHEKGR
ALMKKKEYEIALPYLLDADKHFCECSTELLNTVDNYAVLQLDIVWCYFRLEQLDCLDDAE
KKLSTAHRCFQRCYGENHERLIDIKGSYGREKVLFLRLYLLQGIGHYHSGREKEAAEYIQ
KASCLYEELSIDPDKVDRLSLLGFSEQEARLALRACHGNVEHAANLITNRREEKAQIRRE
ERAKRRQRLEDINTLKSMGYSERAAQVALHNTQGNLDQAFKFILDNPELLLEDDDDDNPV
ATDRFQVSQESIDQLMYMGFSRESAEQALKVFKGNIHLASQTLAHYGGVLPASLQLSPEG
SSPSEESASSKDSPTESAGSSSSPTDEDMETDAVNEILEDIPEHEEDYLDLTLEEEEQII
HEYLSYIQVPQH
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaagaagtatttaatagccaaactgacgagctgcttaagagaggacaaaatt
cagctatggaaaccaccatatacaaatgaaaaaaaagaagctggtaaagagatgaaggag
cttgtacaaaaatactcatccaagctgaatatcaatgagaatgatacagagaatatgctt
gaagaaatacggtgtaaagcaattgagcgtggaacaggaaatgaaaattttaaagtgact
gggattgcgagacttgatatatatctgcctcgtaaaaagagcagaaaaatcccactggaa
actaacctgttcatcacaggcaaggagctcagatcacagatagcacaggaacatgcatta
aaagaaaatgttatcaaaataatcataaataagaagcagcttgacctgggcaaaaccctt
gaagaccagggtgtgacacacaatgcaaaagtgatggtacttcagctggaacagagtgat
gaggaaacaaaaagaagagttcaggaagaagaacttcaatgcaagaaagaaaaggaaata
aatgaaaagatgcaaagaactaaaaagggtttggaaattctagcagaaagagaggaatac
ttggatgcagattctgttccatacctagatatagctaatcaaactggaaggtcaatcgag
attccccctcaggctaaaaaagcccttgtgctggcaatgggttatcatgagaagggcaga
gcattaatgaagaagaaagaatatgaaatagccctgccgtatttgttggatgctgataaa
cacttctgtgagtgtagcacggaactgctgaatactgttgataattatgctgtactgcag
ctggatatagtgtggtgttacttccgcctggagcagctggactgcctggatgatgcagag
aaaaagctgtccacagcacacagatgcttccagaggtgctatggggaaaaccatgaaaga
cttattgatatcaagggaagctatggtcgtgagaaggttttatttctacggctttacctc
cttcaagggataggacactatcacagcggcagagaaaaggaggctgctgaatatattcag
aaggcatcttgtttatatgaagagctgtccatagatcccgataaagttgatcgcctgtca
ctgctgggattctccgaacaggaagctcgccttgccctgcgagcgtgccatgggaacgtg
gagcatgctgccaaccttatcaccaacaggagagaggaaaaggcacagataaggagggag
gagagagctaaaaggcggcagcgactggaagacataaataccttgaaaagtatgggctat
tcagagagagctgctcaagtagctcttcataatacgcaaggaaacctggaccaagccttt
aagtttattctggacaatcctgagttactgttggaagatgatgatgatgacaatcctgtg
gccacggaccggtttcaggtttcccaggaaagtattgatcagctgatgtatatgggtttc
agccgtgagtcagcagagcaagctttaaaggtcttcaaaggcaacatccacttagcttcc
caaacccttgctcattatgggggagttcttcctgcttcgctgcagctgtctccagaaggg
tccagtccatcagaagaatcagcgtcatcaaaagactcgcctacagagtctgcaggttct
tctagttcaccaacagatgaagacatggagactgatgcagtcaatgaaatcctagaggat
attcctgaacatgaagaggattatctggatttaacgctggaggaagaggaacagatcatt
catgaatacttatcctatatacaagtaccacagcattaa

DBGET integrated database retrieval system