KEGG   Falco cherrug (Saker falcon): 102048221
Entry
102048221         CDS       T02911                                 

Gene name
MAPK1
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04012  ErbB signaling pathway
fch04068  FoxO signaling pathway
fch04114  Oocyte meiosis
fch04140  Autophagy - animal
fch04150  mTOR signaling pathway
fch04210  Apoptosis
fch04218  Cellular senescence
fch04261  Adrenergic signaling in cardiomyocytes
fch04270  Vascular smooth muscle contraction
fch04350  TGF-beta signaling pathway
fch04370  VEGF signaling pathway
fch04371  Apelin signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04540  Gap junction
fch04620  Toll-like receptor signaling pathway
fch04621  NOD-like receptor signaling pathway
fch04625  C-type lectin receptor signaling pathway
fch04810  Regulation of actin cytoskeleton
fch04910  Insulin signaling pathway
fch04912  GnRH signaling pathway
fch04914  Progesterone-mediated oocyte maturation
fch04916  Melanogenesis
fch05132  Salmonella infection
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102048221 (MAPK1)
   04012 ErbB signaling pathway
    102048221 (MAPK1)
   04350 TGF-beta signaling pathway
    102048221 (MAPK1)
   04370 VEGF signaling pathway
    102048221 (MAPK1)
   04371 Apelin signaling pathway
    102048221 (MAPK1)
   04068 FoxO signaling pathway
    102048221 (MAPK1)
   04150 mTOR signaling pathway
    102048221 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102048221 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102048221 (MAPK1)
   04210 Apoptosis
    102048221 (MAPK1)
   04218 Cellular senescence
    102048221 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102048221 (MAPK1)
   04520 Adherens junction
    102048221 (MAPK1)
   04540 Gap junction
    102048221 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102048221 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102048221 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102048221 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102048221 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102048221 (MAPK1)
   04912 GnRH signaling pathway
    102048221 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102048221 (MAPK1)
   04916 Melanogenesis
    102048221 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102048221 (MAPK1)
   04270 Vascular smooth muscle contraction
    102048221 (MAPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102048221 (MAPK1)
  09172 Infectious disease: viral
   05164 Influenza A
    102048221 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102048221 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102048221 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102048221 (MAPK1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102048221 (MAPK1)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102048221 (MAPK1)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102048221 (MAPK1)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102048221 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 102048221
NCBI-ProteinID: XP_005445282
LinkDB
Position
Unknown
AA seq 322 aa
MQQCRIRNYVSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDII
RAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNXXXXXXXHKNKVPWNRL
FPNADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDL
PKEKLKELIFEETARFQPGYRS
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcagcagtgcagaattaggaactacgtttctgcctatgataacgtcaacaaagttcga
gttgctataaagaaaatcagtccctttgagcatcagacatactgccagagaactctgaga
gagattaagatcctactgcgcttcaggcatgagaatattattggaataaatgatattatc
agagctccgactattgaacaaatgaaagatgtatacattgtgcaagatcttatggagaca
gatctttacaagctcttaaagactcaacacctcagcaacgaccacatttgttatttcctt
taccagattctgagagggttaaaatatatccattcagccaacgtgcttcatcgcgacctc
aaaccttccaatttgctgcttaacaccacttgtgatctcaagatttgtgacttcggactg
gctcgtgttgcagatccagatcatgatcacacaggattcttgacagaatatgtggccacg
cgttggtacagggctcctgaaatcatgctgaattctaagggttacaccaagtctattgac
atctggtcagtaggctgtattctggcagagatgctctccaacaggcctatctttccagga
aaacactaccttgaccaacttaaccatatccttggtatacttggatccccttcccaagaa
gatttgaatntnnnnnnnnnnnnnnnnncacacaaaaataaggtaccatggaacaggctg
tttccaaatgctgaccccaaagctcttgatttgttggataaaatgttgacctttaatcct
cataagcggattgaagtggagcaagctttagcccatccatatctggagcagtattacgat
ccaagtgatgagcctgtagctgaagcgcccttcaagtttgatatggagttggatgacttg
ccgaaagaaaagctgaaagagctgatctttgaggaaactgctagattccagccaggatat
cgatcttaa

DBGET integrated database retrieval system