KEGG   Falco cherrug (Saker falcon): 102048236
Entry
102048236         CDS       T02911                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04310  Wnt signaling pathway
fch04350  TGF-beta signaling pathway
fch04371  Apelin signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102048236
   04350 TGF-beta signaling pathway
    102048236
   04371 Apelin signaling pathway
    102048236
   04068 FoxO signaling pathway
    102048236
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102048236
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102048236
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 102048236
NCBI-ProteinID: XP_005434789
LinkDB
Position
Unknown
AA seq 553 aa
MPFQGAAPSPVPHRGHVSHLPARCLPRGHRHPVPARWPMPQWWPHRRGQRGRQVPCCGVT
GRAVRCRALQGSSAMSLGAPTSSDVCLSIVHSLMCHRQGGENETFAKRAIESLVKKLKEK
KDELDSLIAAVTTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELK
HVKFCQFAFDLKYDSVCVNPYHYERVVAPTIGLSIQSTVPPTRLVKEEFVHDCVQMEVPP
GREQGAKRALHLPPAAPYRSPVSWTSAAIYAPSRGGAQPTPGPQPSSRSHPQPPLHHPNH
YWPPHHSSGPYQQPVSTHPGPEFWCSIAYFEMDVQVGEIFKVPSSCPVVIVDGYVDPSGG
DRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAVGLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHTPCWIEVHLHRALQLLDEV
LHTMPAAEPGPLH
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgccatttcagggagctgccccatccccggtgccacacaggggccacgtgtcccacttg
ccagcacggtgtctgccccgtgggcacaggcaccccgtaccagctcggtggcccatgcca
cagtggtggccacacaggcgagggcagagggggcggcaggtcccctgctgcggggtgaca
ggcagggccgtgcggtgccgtgccttgcaggggagcagcgccatgtccctcggcgcgccc
acgagcagcgacgtctgcctgagcatcgtgcacagcctgatgtgccaccggcagggcggg
gagaacgagaccttcgccaagcgggccatcgagagcctcgtcaagaagctcaaggagaag
aaggacgagctcgactcgctcatcgccgccgtcaccaccaacggcgcccaccccagcaag
tgcgtcaccatccagcgcaccttggacgggcggctccaggtggccggcaggaaggggttc
ccccacgtcatctacgcccggctgtggcgctggcccgacctccacaaaaacgagctgaaa
cacgttaaattctgccagttcgccttcgacctcaagtacgacagcgtctgcgtcaacccc
taccactacgagcgcgtggtggcccccaccatcggtctgagcatccagagcacagtgccc
cccacgcgcctggtgaaggaggagtttgtccatgactgtgtgcagatggaggtgccgccc
ggccgggagcagggggccaagcgggcgctgcatctgccccccgccgcgccctaccgttca
ccggtgagctggaccagcgcagccatctacgcaccgagccgggggggggcacagcccacc
cccgggccacagcccagcagccggagccacccacagcccccactccaccaccccaaccac
tactggcccccacaccatagctccggaccataccagcaaccggtgtctacccaccctggg
ccggagttttggtgctccatcgcctactttgagatggatgtgcaggtgggggagatcttc
aaggtgccgtccagctgccccgtggtcatcgtggatggttacgtggacccctcagggggg
gaccgcttctgcctggggcagctctccaatgtgcaccgcaccgacgccagcgagcgggcc
cggctgcacatcgggaagggcgtgcagctggagtgccggggcgagggcgacgtgtggatg
cggtgcctgagcgaccacgccgtcttcgtgcagagctactacctggaccgggaggcgggg
agagcccccggggacgccgtgcacaagatctaccctggtgcctacatcaaggtttttgac
ctgcgccagtgccaccgccagatgcagcagcaagcggccacagcccaggctgcagccgcc
gctcaggccgccgccgtggccgggaacatcccaggtcccggctcggtgggaggcatcgca
cccgctgtgggtctttcagcagcggcggggatcggtgtggatgacctgcggcggctgtgt
atcctgcggctgagcttcgtcaagggctgggggcccgactacccccggcaaagcatcaag
cacacgccgtgctggatcgaggtgcacctccaccgcgccctgcagctgctggatgaggtc
ctgcacaccatgccagctgccgagccaggccccttgcactaa

KEGG   Falco cherrug (Saker falcon): 102057734
Entry
102057734         CDS       T02911                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04310  Wnt signaling pathway
fch04350  TGF-beta signaling pathway
fch04371  Apelin signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102057734 (SMAD4)
   04350 TGF-beta signaling pathway
    102057734 (SMAD4)
   04371 Apelin signaling pathway
    102057734 (SMAD4)
   04068 FoxO signaling pathway
    102057734 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102057734 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057734 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102057734
NCBI-ProteinID: XP_005438020
LinkDB
Position
Unknown
AA seq 551 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSSAPSSMLVKDEYVHDYEGQPSLSSAEGHSV
QTIQHPPSNRASTEPYSTPAMLAPTEASTTSTTNFPNIPVASTSQPTSILTGSHSDGLLQ
IASGPQPGTQQNGFTAQPATYHHNSTTTWTGSRTAAYTPTIPHHQNGHLQHHPPMHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDR
FCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRA
PGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPA
ISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLH
TMPIADPQPLD
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattactaacacaccaacaagtaatgatgcttgtctgagcattgtt
cacagcttgatgtgccatcgacaaggtggagagagtgaaacttttgcaaaacgcgcaatt
gaaagtttagttaaaaagctaaaggagaaaaaagatgaattggattctttgattacagct
ataaccacaaatggagctcatcctagcaagtgtgttacaatacagagaacgctggatggg
aggcttcaggtggctggtcgcaaaggattccctcatgtgatttatgctcgtctttggagg
tggcctgatcttcataaaaatgaactcaagcatgttaaatattgtcagtatgcttttgac
ttaaaatgtgacagtgtctgtgtaaatccttaccattatgagcgtgtagtatcacctggc
attgacctctcaggactgacactacagagttctgctccatcaagcatgttggtgaaagac
gaatacgttcatgactatgaggggcagccatcattgtcttctgctgaaggccattcagtc
caaaccatccagcacccaccaagtaacagggcatctacagagccttatagcaccccagcc
atgttagctcctactgaggctagcactaccagcaccactaattttcccaacattcctgtg
gcttcaacaagtcaacctaccagtatattgacaggtagccatagtgatggactcttacag
attgcttcagggcctcagccaggaactcagcagaatgggtttacagctcagccagctact
taccatcacaacagtactacaacttggactggaagtcggacggcagcctacacgcctacc
atacctcaccaccagaatggccatcttcagcatcatccacctatgcatcctggacattac
tggccagttcacaatgaacttgcattccagccacctatatcaaatcatcctgctccagaa
tattggtgttcaatcgcatattttgaaatggacgtgcaagttggagaaacatttaaggtc
ccttcaagctgtccgatcgttacggttgatggatatgtggatccttctggaggagaccgt
ttttgcctgggccagctttccaacgtgcatagaacagaagccattgaaagagcaaggttg
cacataggtaaaggggtgcagttggagtgcaaaggagaaggtgacgtgtgggtgcgatgc
ctcagtgaccatgcagtcttcgttcagagttactacctggacagagaagcagggcgtgca
ccaggggatgctgttcacaagatatacccaagtgcatatataaaggtgtttgatttacgc
cagtgtcatcgtcagatgcaacagcaggctgccacggcgcaagctgccgctgctgctcaa
gctgcagcagtagcaggaaacatccctggaccaggatcagtaggtggaatagccccagcc
attagtttgtctgctgctgctggaatcggtgtagatgacctccgccgcttatgcatactc
aggatgagttttgtaaaaggttggggacctgattacccaagacagagcatcaaagagaca
ccgtgctggattgaaattcacttacaccgtgccctccagcttctagatgaagtacttcat
accatgcctattgcagacccacaacctttagactga

DBGET integrated database retrieval system