KEGG   Falco cherrug (Saker falcon): 102048522
Entry
102048522         CDS       T02911                                 

Gene name
SORBS1
Definition
(RefSeq) sorbin and SH3 domain-containing protein 1 isoform X1
  KO
K06086  sorbin and SH3 domain containing protein 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch03320  PPAR signaling pathway
fch04520  Adherens junction
fch04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102048522 (SORBS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102048522 (SORBS1)
   03320 PPAR signaling pathway
    102048522 (SORBS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fch04990]
    102048522 (SORBS1)
Domain-containing proteins not elsewhere classified [BR:fch04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102048522 (SORBS1)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Other DBs
NCBI-GeneID: 102048522
NCBI-ProteinID: XP_027672618
LinkDB
Position
Unknown
AA seq 1403 aa
MAPLTEKPESRHKQNPEVKKASPSTTMSSEHEEMDVTKTVVNGLSTNGQEKAVGVPLCTR
SISAVKIIPVKKVKSSPHLVLPTETDPTKVCSGKGAVTLRASPAYEENQNITSPCPQNVE
QPESLEPENPETDEWRSSSNTDANGDAQPSSLAAKGYRSVRPNLSSDSKPQALAPPRPPL
PKEESFAWRPRTDTKVTNLLPVPIMDCVYLNAPKPYTQRASPNTSARCYFSSPTPYGAIP
RGKQGLPAGHSLSSGPKDEMHAGRPLLESRSSLDASSIQRNPDRADPSKAGMNSSHETKA
DKKVTKLYVACLSNSTCSAASENSTGTTHDPAASTSLGAELTEAPATDIVSSVTDTGKSL
PAPPPPPVPPRPYFYIVLSKDAVSYGAGQPSWTQSSPPQAVRDRVLEPQSTAATEDRMRK
EPYLAQQRQPPYKAMGRSMDATATTTAQPGVIVVPLLQVNPERQQEGSSSTPPPPLVPFG
QGSISPETVPPGSPLTFPTLDDFIPPHLQRGSHHNQAPSASGTLPSVYPKLPFFSSPPSL
VPPVTGALHRGLKPEITGVISRTDPGSVLNEVPQPGAGTDYPTSFTSINKSSSAYPSTTI
VNPTIVLLQHNREQQKRLSSLADSVPDRVVSDKVDSALIRDKPVQEAVPSERKAMEEKRS
IVRSPQHMADTSVDDIGIPLRNTDRSKDWYKTMFKQIHKLNRDTPEENPYCPTYIFPELP
EIQQKTEEDNPYSPTYQFPASTPSPISEDEDSDSYSPRYSYSEDSRTQLSVPRSKSETDS
IDSEKVVKRSATLPLPNRTSSLKSSPERTDWEPPDKKVDTRKYRAEPRSIYDYQPGKSSV
LNNEKMTRDISPEEIDLKNEPWYKFFSELEFGKPPFVHMPPKKIWDYTPGDCSILTREDR
KSDLEKDLYLYQTELEADLEKMEKLYKAPHKKPQKNTAGVAPLETSTDHSSYSTYSPIYQ
AVKRETEPALGDPAGLENERQIYKSVLEGGDIPFQGLSGLKRPSSSASTKVDRKDSESPR
HFAPVDYMETPEEIIRRRHDDKEKLLEDQRRLKREQEEADIAARRHTGVIPTHHQFITNE
RFGDLLNVDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEH
HGRVGIFPQSYIELLPPAEKAQPKKPSPLQVLEYGDAIAKFNFNGDTQVEMSFRKGERIT
LIRRVDENWYEGKISGTNRQGIFPVTYVEVLKRPVVKNAIDYPDPPVSLSPSRSMTASPQ
PSHHSLRAGPDLTESEKSYVEAVCNEIINIAEKSVHYCSTISQPLDSRHKVTPNDHKPSL
IISQQPQAQQQGTSPDRSQTPRDIVSYQALYSYTPQNDDELELRDGDIVDVMEKCDDGWF
VGTSRRTRQFGTFPGNYVKLLYL
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggcaccattaactgaaaagcctgaatcaagacataaacaaaacccagaagtgaaaaag
gcaagtccctccaccacgatgagctctgaacacgaagaaatggatgttacaaaaactgtt
gtcaatgggctgagcaccaatggacaagaaaaagctgttggcgtccctttatgtacacgc
tctatttctgccgttaaaataatccctgtgaagaaagtgaaaagttctcctcacctagtg
ctgcctacagaaacggatcccactaaagtctgcagtggaaaaggagcagtgaccctccgg
gcatctccagcctacgaagagaatcagaatatcacctcgccatgtcctcagaatgttgag
caacctgaaagtctggagccagaaaacccagaaacagatgaatggaggtcatcatctaac
accgatgccaatggggatgcccagccatcttctctggctgccaagggttataggagcgtg
cgtccgaacctttcctcagacagcaagccacaggcccttgctcctccccgtcctcctctt
cccaaagaggagagctttgcatggcgtcctcgcactgacactaaagtgaccaacctgttg
cccgtgcccatcatggactgcgtgtacctgaatgcgcccaagccttatacacagcgtgca
tcaccaaacaccagtgcacggtgttatttctcatcaccgaccccctacggggccattccc
cgtgggaagcaaggcttgccagcagggcattctctctcttcaggccccaaagatgagatg
catgctgggcggcctctcttggaaagtcgctcctcgttggatgcatcatccatacaacgc
aaccctgacagggcagatcccagtaaggctggaatgaattccagtcatgagacgaaggcg
gataaaaaggtcaccaaactatatgtagcttgtttatctaacagcacttgctcagctgca
tctgaaaattccactggcaccacacatgacccagcagccagcaccagtttgggtgctgag
ctcactgaggcaccagccaccgacattgtttcctctgtaacagatactggaaagtctctt
cctgctcctcctcctcctcctgttcctcccaggccgtacttttacattgtcctcagtaaa
gacgcagttagttatggtgcgggccagccctcctggactcagtcgtcacctccgcaggct
gtgagggacagagtgctagagccccagagcacagctgccacagaggacaggatgagaaaa
gagccttaccttgcccagcagcgacagccgccgtacaaggcgatgggacgcagcatggat
gccactgccaccaccacagctcagcctggggttatagtagtccccctcctgcaggttaat
ccagaaagacaacaagaaggcagctccagcactccaccaccacctctggttcctttcggg
caaggctccatatcccctgagactgttcctcctggctcacccttgactttcccgactcta
gacgatttcattcccccacatctccagaggggttcccaccataaccaagcaccctctgca
tctggcacattaccctctgtttacccgaaactgccattcttctcatcaccaccttcactt
gtccctccagtcacgggggctttgcacaggggcttgaagcctgaaatcactggagtcatc
tcacgtacagacccaggttctgtgctaaatgaggtgccccagcctggcgctggcactgat
tatccaacctccttcacttcaatcaacaagtcttcctctgcctatccctctaccacaatt
gtcaatcccactattgtcctcttgcagcacaatcgagaacagcaaaaaaggcttagtagc
ctggcagattcagtgccagacagagtagtttctgataaagttgattcagcgctcatacgg
gacaagccggttcaggaggcagtgccgagtgagaggaaggcaatggaggagaagagaagc
atcgtcaggagccctcagcacatggctgatacctccgtcgatgacattggcattccgctg
aggaatacagacagatcgaaggactggtacaagacgatgttcaaacagattcacaagcta
aatagagacactcctgaagaaaacccttattgccctacctacatatttcctgaacttcct
gaaatccagcaaaaaactgaagaagacaatccttattctcctacataccagtttcctgcg
tctactcctagtcctatatctgaagatgaagattctgattcatactctcctcgttattcc
tattctgaggacagcagaacccagctttcagttccccgttccaagagtgagacggacagc
attgattcggagaaggttgtgaagaggtctgccaccttgccactgccaaaccgtacttca
tcactgaaatccagcccagaaaggactgactgggagcctccagacaagaaggtggatacc
agaaagtaccgtgcggagcccaggagcatttatgactatcagccaggaaagtcctcagtt
ctgaacaatgaaaagatgactcgggatataagcccagaagagatagatttaaagaatgaa
ccttggtataaattcttttcggaattggagtttgggaaaccgccatttgttcacatgcct
ccaaaaaagatttgggattatactcctggagattgctctatccttactagagaggataga
aagagtgatctagaaaaagacctctacctctaccagactgagttagaggcagatttagaa
aaaatggagaagctttataaagcgccacataaaaagccacagaagaatacagcaggtgtt
gctcccctggaaacttccacagaccattcttcctactccacgtattcacccatctatcag
gcagtgaagagggagacagaaccagcactgggggaccctgctggcttggagaatgaaagg
cagatttacaagagtgtgctggaaggtggagatatcccgttccaggggctgagtggtctc
aagagaccttctagctccgcttccacaaaagtggatcgtaaagattcagaatcaccaagg
cattttgcaccagttgattacatggaaactccagaagaaattatccgcagacggcatgac
gataaagagaaacttttagaggaccagagacggcttaaacgtgagcaagaagaagctgat
attgcagctagaaggcacacaggggttattccaacgcaccatcagtttatcactaatgag
cgatttggggacctcctaaatgtagacgatacagcaaagaggaaatctgggtcagagatg
agacctgctagagccaagtttgactttaaagcacagacgctaaaggagcttcctctgcag
aaaggagatattgtttacatttacaagcagatcgaccagaactggtatgaaggcgaacac
cacggcagagttggcatcttcccacaatcgtacatagagctgctcccaccagctgagaaa
gctcagcccaaaaagccatcaccgttgcaggtattggaatatggagatgctattgccaag
ttcaacttcaatggggatacccaagtggaaatgtccttcagaaagggtgaaaggatcaca
ttgattcgacgagtggatgagaactggtacgaaggaaaaatctctggcaccaatcgccaa
ggcatcttccctgtcacttacgtggaggtgctcaaacggccagtggtcaagaatgccatt
gactaccctgacccaccagtgtccctctcccccagccgcagcatgacagcttcaccacag
ccttcccaccattcattgagagctggaccagatctcacagagtctgaaaagagctatgtg
gaagctgtttgcaatgagatcataaacattgcagaaaaatctgttcattactgcagtact
atttctcagcctcttgactctcgccacaaggtgacccctaatgaccataaaccatctctc
atcatttctcagcaacctcaagcacagcagcaaggaaccagccctgacagaagtcaaacg
ccacgagacatagttagctaccaagccctctacagctacactcctcagaatgatgatgag
ctggaactgagggacggtgacattgttgatgtcatggagaaatgtgacgatggctggttt
gtgggtacgtccaggagaacaagacaatttggcaccttcccaggcaactacgtgaagctt
ctgtacctgtaa

DBGET integrated database retrieval system