KEGG   Falco cherrug (Saker falcon): 102048568
Entry
102048568         CDS       T02911                                 

Definition
(RefSeq) protein snail homolog Sna
  KO
K05707  snail 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102048568
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102048568
Transcription factors [BR:fch03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    102048568
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2HE zf-Di19
Other DBs
NCBI-GeneID: 102048568
NCBI-ProteinID: XP_027669375
LinkDB
Position
Unknown
AA seq 277 aa
MVTVPPPPAVLAAPLLYETCPLPVIPPPEVLGPGAYYPPLVWDAGLLSSLFPGGPGSEAA
GGTTPALDLTALSSEEDEGKSSGPPSPASAPAAAERFRCAQCAKAYSTFAGLSKHKQLHC
DAQARKSFSCKYCEKEYVSLGALKMHIRSHTLPCVCKMCGKAFSRPWLLQGHIRTHTGNA
GSRPSPSLPYRLPLPSSEAPSEWAGRVLSGKIRASQTPLAHLSKMSFKYPLGWNRAQGQG
SARKSVPLLLVLCLPVSQPQGHSVTAHTSPQFHKLGL
NT seq 834 nt   +upstreamnt  +downstreamnt
atggtcactgtgccgccgcctcccgcagtgctggccgccccgctgctgtacgagacgtgc
ccgctgcccgtcatccccccgcccgaggtgctcggccccggcgcctactacccaccgctg
gtgtgggatgcggggctgctctccagcctcttcccgggcggcccgggcagcgaggcggca
ggcggcacgacccccgccctggacctgaccgcgctctccagcgaggaggatgaaggcaag
agctcggggccccccagcccagcctcggcccccgccgccgccgagcgcttccgctgcgcc
cagtgtgccaaggcttactccaccttcgccgggctctccaagcacaagcaattgcactgc
gacgcccaggccaggaaatccttcagctgcaagtactgcgagaaggagtacgtgagcctg
ggggctctcaagatgcacatccggagccacacgctgccctgcgtctgcaagatgtgtggc
aaggccttctcccggccctggctgctgcagggccacatccggacgcacaccggtaatgcc
ggctctcgcccctctccctccctcccttatcgcctcccgcttcccagctccgaggccccc
agcgaatgggcaggccgggtgttatctgggaagataagagcttcccaaacccccttggca
catctctctaaaatgtcctttaaatatcctcttggctggaaccgagcacagggtcaaggc
tctgctcggaaatctgtgccgctgctgttagtgctgtgtctgcccgtgagccagccccag
ggccacagtgtgacggcgcacacttcaccccagtttcataaactggggctatga

DBGET integrated database retrieval system