KEGG   Falco cherrug (Saker falcon): 102048630Help
Entry
102048630         CDS       T02911                                 

Gene name
MAP3K14
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04210  Apoptosis
fch04625  C-type lectin receptor signaling pathway
fch04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102048630 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102048630 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102048630 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102048630 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102048630 (MAP3K14)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102048630 (MAP3K14)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: STE group
  Other
   102048630 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102048630
NCBI-ProteinID: XP_005447048
LinkDB All DBs
Position
Unknown
AA seq 933 aa AA seqDB search
MAVMGITCQGSPDPAVKHKKELTATKGLNESVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTKKKRHKKRSKLKVQTVAAGRRGPRTPEQESCTPIPVQED
ESHQNTLYRNRFWVSEFNKDLVYDPLPFEKPEKVLSTGKLHSPGSKYKAELHKLISPIQC
LNHVWKRHYQRDSVPQPETLHPFPXXXXXXLHSPPPAMKRNALETYLHGDLNYQDSEHRL
SGLNLEYSFPKCINQSVKTSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGGGLDL
KEQFHEANENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCA
AKKVQVEHFRAEELTTCAAVTSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCL
PEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLG
KSLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLK
IAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTSPWKG
EYREPRHLSLNKENNPQTSLSPTVSPVSETVSDPKLAVKVSCASAVLPLPPLEQTEEVEG
TPWNVCKELSETWDPPPLSSTPLLLKSCSHVEKATTISEQELQQLEIELFLNSLSQPYSL
EEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQADGQSFSXNRHTDT
PSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQSVHYDME
VPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccagggatctcctgatccagccgtcaagcacaagaag
gagctcacagctaccaaggggctgaacgagtcagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcgaagaaggtcatctttcacagccagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgctcatagtaagcgttacagccggtcagacagtctcgatcaaatccctaacaatgtg
gcccatgcaacggagggaaagatggcacctacctgttggagagggaggcatcgtggcaag
acaaaaaagaaacgtcacaagaaaagatccaagctgaaagtacaaacagtggctgctggc
aggcgcggtcccagaactccagagcaagagagctgcaccccaattcctgtccaggaggat
gaatcacaccaaaatactctttacagaaaccgtttctgggtttcggaatttaacaaggac
ttggtctatgatccactgccatttgagaaacctgagaaagttctgtccacaggcaaactc
cattcaccagggagcaaatacaaagcagaactgcacaagttgataagccctattcagtgc
cttaatcatgtttggaaacggcactatcagagggacagtgttccacagcctgaaactctc
catccttttcccntannnnnnnnnnnnnntctgcacagccccccccctgccatgaaacgt
aacgctctggagacgtacttgcatggtgatctcaactatcaagacagtgagcatcgctta
tctggcctaaacttagaatatagtttccccaaatgcatcaaccagtctgtgaaaaccagt
tcagacaagatttctgtggaagaatacttggtagacgccttgaaggggagcgtgagtctt
ggtgaaccacaaaatttagccagcctagccaagacgtggagaggaggtggtttggacctg
aaggaacaatttcatgaagccaatgaaaatgaaggcgtgctacttaacgagaaactaaag
ccagtggattatgagtaccgagaagaggttcattggaccaagtgtcatggttctttgggc
attggctcttttggagaagtatacaaaatagaggataaacagacaggatttcagtgtgct
gccaaaaaggtacaagttgaacacttccgtgcagaagagttaacaacatgtgctgcagta
acgagtcctaaagttgtccccttgtacggagctgtgaaggaaggaccttgggtgaccatc
ttcatgaagctgatggagggcggctcactaggtcagctaattaaacagagcggctgcctg
ccagaggacagagccctcagttatttgggccaggcactggagggcttggagtatcttcat
gctcaaaacattctccatggagatgtaaaagcggaaaatgtgctcttgtctgatgatgga
agcagggctcttctgtgtgactttggtcactctgctcaccttcatccagatggcctggga
aagtccttggtcacagggaactatgtacctggcacggagactcatatggctccagaggtg
gtgatgggaaagcgttgtgactccaaagtggatgtctggagcagttgctgtatgatgctg
catatgcttaatgggtgccacccttggacccagtattacaatcacccactctgtctgaag
atagctaaagagccacctcctctgagggaaattccaccttcctgcaaccctctgactgct
gagattattaagatgggtctggagaaagagcctgttcagagagcatctgcatctgaactg
aaaactaagactagtgtcgcacttgaagaagtgggaggtgtgacaagcccctggaaaggc
gaatacagagagcctaggcatttatctttgaacaaagaaaacaatccacagacatccctg
tcccccacagtcagcccagtttctgagactgtttctgacccaaaattggcagtcaaagtt
tcttgtgcaagcgcagtcctaccactgccacctctagagcaaaccgaggaggtcgaggga
accccttggaatgtgtgcaaggaattatcagagacctgggatcctccacctctctcctcg
actcctctccttttgaagagctgcagccatgtggagaaagcaacaaccatctcagaacaa
gagcttcagcagctggaaatagaactgtttttgaacagcctttcacagccttactcgctg
gaagagcaagaacaaatgctttcatgtctcagcatcgacagcccatttgtgtcagatgct
agtgagaagaactccatgaaggcttctcatagcttgagggacactatgagctctggaatt
cattcctggaacagccaggcagatggacagagcttcagtngcaatcggcacacagacact
cctagctatttcaacggagtgaaaatccagatccagttgctaagtggagaaaatttacac
atcagggattttcataggacaaaggtgggagacattgccactgggataagcagccagata
ccagttcctgctttcagtctggttactaaagaaggccagtcagttcactacgacatggag
gtccccgactctggtattgagctgcaatgcacccttgcccctgactgcagcgtcagctgg
acatggcgagtcaaacatggtcagctggagaacagaccatga

DBGET integrated database retrieval system