KEGG   Falco cherrug (Saker falcon): 102048632
Entry
102048632         CDS       T02911                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04060  Cytokine-cytokine receptor interaction
fch04068  FoxO signaling pathway
fch04144  Endocytosis
fch04218  Cellular senescence
fch04350  TGF-beta signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102048632
   04350 TGF-beta signaling pathway
    102048632
   04068 FoxO signaling pathway
    102048632
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102048632
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102048632
  09143 Cell growth and death
   04218 Cellular senescence
    102048632
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102048632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102048632
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102048632
Protein kinases [BR:fch01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102048632
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 102048632
NCBI-ProteinID: XP_027665369
LinkDB
Position
Unknown
AA seq 562 aa
MGYWRKPGLLALLLLSFSCSAGARRSLKTNLCKWCDSTPPACEEKVCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSEDGIIYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVTFYLCRTQKQRKRAK
AWGGKAGQPPALPEQGRSAEREEKLSVLMDESPACAGPTSRPAELLPIELDEMVGKGQFA
EVWRAKLSHSRSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLKHDSVLRFLTAEDRGTG
PRREYWLITAYHSRGNLKDYLSHHVLSWMDLQKMAGSLVSGVAHLHSDYTACGRPKIPIA
HRDIKSTNVLVKNEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLESRVNL
EDLESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRG
RPEIPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNTDN
EASKTASPGGEHQDSDGSRNTQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgggttactggaggaaaccgggtctgcttgccttactgctgctctccttctcttgcagt
gctggtgctcgccgcagccttaagaccaacctgtgcaagtggtgcgactccacgccgccg
gcctgtgaggagaaggtgtgctacagcaactgcaacctcaactcctactgtgaggacccc
tacgagatctgcgtggccatatggagacaggacaatgagagcatcaggatcagcacgctg
tgccacaatccccaccgccctatcgaaaacctcatggtccccaactacaacacgtcacgc
tgcatcatgacccaccagcccagcgaggacggcatcatctacatctgcggctgcgtggac
gagcaggagtgcaacgataaactgatctttgaaaaccacaccaacggctactccatgctg
cagagcaaggaggtgatcccggtggccgccatcagcctcctgcccccgctgctggtggcg
gtgatgatcacggtgacattttacctctgccgcacgcagaagcagcgcaagagagccaag
gcgtggggtgggaaagcgggacagcccccggcgctgccagagcaggggaggtctgctgag
cgggaggagaagttgtccgtgctgatggacgagagcccggcctgtgccggccccaccagc
cgccccgccgagctgctccccattgagctggacgagatggtgggcaaagggcagttcgcg
gaggtgtggagggccaagctgagccacagccgctcggggcagtacgagacggtggctgtg
aagatcttcccctgtgaggagtactcctcctggaagaacgagagccagattttcaccgac
accagcctcaagcatgacagcgtcctgcggttcctcactgccgaggaccggggcacaggg
ccacgccgggagtactggctcatcactgcctaccacagccggggcaacctcaaggactac
ttgtcccaccacgtcctgagctggatggacctgcagaagatggcgggctccctggtgagc
ggggtggcccacctccacagcgactacactgcctgtggcaggccgaaaatccccatcgcc
caccgggacatcaaaagcacgaacgtcctggtgaagaacgagcaggagtgcgtgctctgc
gacttcggcatcgccatacgcctcgacccttccctgacagtagatgactttgccaacagc
gggcaggtgggcaccgccaggtacatggccccagaggtcctggagtccagggtgaacctg
gaagacctggagtctttcaagcagatggatgtctactccatggccctcgttttatgggaa
atggcctccagatgtgaagtggtaggagaggtaaagaattatgagctgccttttgggtca
aaagtccaggagcagccctgtgtggacaccatgagggacatcgtgctgcatggcagaggg
cgacccgagatcccaagcagctggctggtgcatcagggaatgcgttttctgtgcgacacc
atcacagagtgctgggaccacgaccctgaggctcgcctcaccgcccactgcgtggccgag
cgcttcaacctgatggcacagatggattgcgacgacatcctcaacaacaacactgacaac
gaggccagcaaaacagcttctccaggtggggagcaccaggacagtgacgggagcagaaat
acgcagtga

DBGET integrated database retrieval system