KEGG   Falco cherrug (Saker falcon): 102048669
Entry
102048669         CDS       T02911                                 

Gene name
ACTN1
Definition
(RefSeq) alpha-actinin-1
  KO
K05699  actinin alpha 1/4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102048669 (ACTN1)
   04520 Adherens junction
    102048669 (ACTN1)
   04530 Tight junction
    102048669 (ACTN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102048669 (ACTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102048669 (ACTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102048669 (ACTN1)
   04147 Exosome [BR:fch04147]
    102048669 (ACTN1)
Membrane trafficking [BR:fch04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102048669 (ACTN1)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102048669 (ACTN1)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102048669 (ACTN1)
  Exosomal proteins of colorectal cancer cells
   102048669 (ACTN1)
  Exosomal proteins of bladder cancer cells
   102048669 (ACTN1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_5 XisI Uds1
Other DBs
NCBI-GeneID: 102048669
NCBI-ProteinID: XP_027663806
LinkDB
Position
Unknown
AA seq 893 aa
MCPVDSAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPE
RGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISV
EETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDP
LTNLNTAFDVAEKYLDIPKMLDAEDIIGTLRPDEKAIMTYVSCYYHAFSGAQKAETAANR
ICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRR
LHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEW
LLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLKKHEAFE
SDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTE
KLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDA
DKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPHEINGKWEHVRQLVPRRDQALMEE
HARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYEKSIVNY
KPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDAQKKTGMMDCEDFRAC
LISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGD
KNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgtgtcctgttgactcagcgtgggagaagcagcagaggaagacatttacagcatggtgt
aattctcacctccgcaaggctgggacacagattgagaacatagaggaagatttcagggat
ggtcttaaactcatgttacttctggaagtcatttcaggtgaacgtttggctaagcctgaa
agaggcaaaatgcgagtgcacaaaatatctaacgtgaacaaggccttggatttcattgcc
agcaaaggggtcaaactagtgtctattggagcagaagaaatcgtggatggcaatgttaaa
atgactcttggaatgatctggaccatcatccttcgttttgccattcaggatatttcagtt
gaagagacatctgctaaagaaggacttttgttatggtgtcagaggaagacggccccctac
aaaaatgtaaacatccagaacttccatatcagttggaaagatggccttggtttctgcgct
ttaattcatagacaccgtccagagctcattgactacgggaagctacgaaaggatgatcct
ctcactaatctaaacacagcttttgatgtggctgagaaatatctggatattcccaagatg
ctggatgcagaagatattataggcacgctaaggccggatgagaaggccataatgacctat
gtctcatgttactaccacgccttctcaggggcgcagaaggcggagacagcagcaaatcgt
atctgcaaggtgctggcagtcaaccaagaaaatgaacagctcatggaagactacgaaaaa
ctggccagtgatctgctggagtggatccgtcgcaccatcccctggctggagaaccgggcc
ccagagaacaccatgcaagccatgcagcagaaactggaagacttccgggactatcgccgc
ctgcacaagccccccaaggtccaagagaagtgccaacttgagatcaatttcaacaccctg
cagaccaagctgcggctcagcaacaggccagccttcatgccttcagaagggaaaatggtc
tcggatataaacaatgcctggggtggcctagagcaggctgaaaagggctatgaggagtgg
ttgttgaatgagatccggaggctagagaggctggatcacctggcagagaagttccggcaa
aaggcatccattcatgagtcctggacagatggtaaggaagcaatgctgcagcagaaggat
tatgaaactgctaccctctcggagataaaggccctgctgaagaaacacgaggcctttgag
agcgacctggctgcacaccaggaccgcgtggaacagattgctgctattgcacaagagctg
aatgagctggactattatgactctccaagtgttaatgccaggtgccagaagatctgtgat
cagtgggataatctgggtgccctaacccagaaacgtagagaagccttagagaggacagag
aagctactggaaacaattgaccagttgtacctggaatatgccaaacgagctgcccctttc
aataactggatggaaggggccatggaggacctgcaggacacattcattgttcacaccatt
gaggagatccagggattaaccacagcccatgaacagttcaaagccactttgccagatgcc
gacaaggagcgacaggccatcctgggaatccacaatgaagtctcaaagattgtccagaca
taccatgtcaacatggcaggaacgaatccttacactacaatcaccccacatgagatcaat
ggcaaatgggaacatgtgcggcaactagttcccaggagggatcaagccctgatggaagaa
catgctcgccagcagcaaaatgaacgactccgtaaacaatttggtgcacaagccaatgtc
attggaccctggatccagacaaagatggaggagattggacgcatttcaatagagatgcat
gggaccctggaggaccagctcaatcacctgcggcagtatgagaaaagcattgtgaattac
aaaccaaagattgaccagctggaaggagaccatcaacagatccaggaagcgctcatcttt
gacaacaagcacaccaactacaccatggagcatatccgggtgggctgggagcagttacta
acaacaattgctagaaccatcaacgaagtggaaaaccagattctgacccgtgatgccaaa
ggaatcagccaggaacagatgaacgagttccgggcttctttcaaccattttgacagggac
cactccggcacacttggccctgaggaattcaaagcctgtctcatcagcttgggttacgat
attggaaacgatgcacagaagaagactggtatgatggattgtgaagatttccgagcctgc
cttatctccatgggttacaatatgggagaggcagagtttgcccgcatcatgagtatcgtt
gaccctaaccgtttgggtgtagtgacgttccaggccttcattgacttcatgtcccgggaa
acagcagatacagataccgctgaccaggttatggcttccttcaagatcctggctggagat
aagaactacatcactgtggatgaattacggcgggaactgcctcctgatcaggctgaatat
tgcattgctagaatggcaccctacaatggccgtgatgctgtacctggtgccctggactac
atgtccttctccacggcactctatggcgaaagtgacctttaa

KEGG   Falco cherrug (Saker falcon): 102059725
Entry
102059725         CDS       T02911                                 

Definition
(RefSeq) alpha-actinin-4-like
  KO
K05699  actinin alpha 1/4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102059725
   04520 Adherens junction
    102059725
   04530 Tight junction
    102059725
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102059725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102059725
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102059725
   04147 Exosome [BR:fch04147]
    102059725
Membrane trafficking [BR:fch04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102059725
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102059725
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102059725
  Exosomal proteins of colorectal cancer cells
   102059725
  Exosomal proteins of bladder cancer cells
   102059725
SSDB
Motif
Pfam: CH EFhand_Ca_insen Spectrin CAMSAP_CH EF-hand_1 EF-hand_8 CactinC_cactus
Other DBs
NCBI-GeneID: 102059725
NCBI-ProteinID: XP_027660039
LinkDB
Position
Unknown
AA seq 668 aa
MYRCVLPTTFRANIVELPGSEGSGRLSVRAASQAKVRGSVWLKRKEKAAKTCRDRPGLSP
TFTAWCNSHLRKAGTQIENMGRHPPFPTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLL
LEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIW
TIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRP
ELIEYDKLRKXXPVTNLNNAFEVAEKYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHA
FSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIKRTIPWLEDRSPQKTIQE
MQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMAHDQFKST
LPDADKEREAILGIQREAQRIADFNSIKLSGNNPYTSVTPQIINSKWERVQQLVPKRDHA
LQDEQSKQQSNEHLRRQFASQANIVGPWIQTKMEEIGRISIELHGTLEAQLAQLKQALQD
GGGGVGSSAPTPLTAPLSPSLLQGDAEFNRIMSVVDPNNSGIVTFQAFIDFMSRETTDTD
TADQVIASFKVLAGDKNYITAEELRRELPPEQAEYCIARMAPYQGPDAVPGALDYKSFST
ALYGESDL
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgtaccggtgtgtcctgcccacgactttccgagcaaacatcgtggagctgccgggctcc
gagggcagcgggcggctttcggtcagggctgcgagtcaggctaaagtccgcggcagcgtt
tggcttaagaggaaggaaaaagctgcaaaaacctgccgggatcgtcccgggctgagcccg
accttcacggcgtggtgcaactcccacctgcggaaggccggcacgcagatcgagaacatg
ggcaggcatccccctttccctaccttcacggcgtggtgcaactcccacctgcggaaggcc
ggcacgcagatcgagaacatcgacgaggatttccgcgacggcctcaagctcatgctcctg
ctggaggtgatttcaggggaacgattgccaaaaccggagcggggaaaaatgagagtgcat
aaaatcaacaacgtgaacaaagccctggatttcatcgccagtaaaggcgtcaaactggtc
tccataggagccgaagagatcgtcgatggcaacgccaagatgacgctgggcatgatctgg
accatcatcctgcggtttgccatccaggatatctcggtggaagagacctcggccaaggag
gggttgctgctctggtgccagaggaagacggcgccttacaagaacgtcaacgtgcagaat
ttccacatcagctggaaggacgggctggctttcaacgccttgatccacaggcacaggcca
gagctgatcgaatacgacaaactcaggaaggnnnatccggtgacgaacctgaacaacgcc
ttcgaagtggcggagaagtacctggacatccccaagatgctggatgcggaggatatcgtg
ggcacgctcaggcccgacgagaaggccatcatgacatacgtgtcctgcttctaccacgct
ttctcgggggcgcagaaggctgagacggcggcgaaccgcatctgcaaagtgctggccgtc
aaccaggagaacgagcacctgatggaggactacgagaaactggcctccgacctgctggag
tggatcaagcgcaccatcccgtggctggaggaccgcagcccccagaaaaccatccaggag
atgcagcagaagctggaagatttccgcgattaccggcgggtccacaagccccccaaggtg
caggagaagtgtcagctggaaattaatttcaacacgctgcagaccaagctgcgcctgagc
aaccggcccgccttcatgccctccgaggggaggatggctcacgaccagttcaaatccacc
ctccccgacgccgacaaggagcgcgaggccatcctgggcatccagcgggaagcgcagcgc
atcgccgacttcaacagcatcaaactctccgggaacaacccctacacctccgtcaccccc
cagatcatcaattccaagtgggaacgggtgcagcagctggtgccgaagcgggaccacgcg
ctgcaggacgagcagagcaagcagcagtccaacgagcacctgcggcggcagttcgccagc
caggccaacatcgtggggccctggatccagaccaagatggaggagatcgggcgcatctcc
atcgagctgcacggcacgctggaggcgcagctggcgcagctgaagcaggcactgcaggat
ggtgggggaggggtgggatccagcgctcccacccccctcaccgcccccctgtccccttcc
ctgctccagggcgacgccgaattcaaccggatcatgagcgtggtggatcccaacaacagc
gggatcgtcactttccaggcgttcatcgacttcatgtcgcgggaaaccaccgacacggac
acggcggatcaggtcatcgcctccttcaaagtcctggcgggcgacaagaactacatcacg
gccgaagagctgcggcgggagctgccccccgagcaggcagagtactgcatcgcccgcatg
gctccctaccaggggcccgacgccgtgcccggcgccctggactacaaatccttctccacc
gcgctgtacggcgagagcgacctctga

DBGET integrated database retrieval system